Glutathione Transferase zeta 1 (GSTZ1) (NM_001513) Human Recombinant Protein
CAT#: TP314568
Recombinant protein of human glutathione transferase zeta 1 (GSTZ1), transcript variant 3, 20 µg
View other "Glutathione Transferase zeta 1" proteins (2)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC214568 representing NM_001513
Red=Cloning site Green=Tags(s) MQAGKPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDFQALNPMKQVPTLKIDGITIH QSLAIIEYLEEMRPTPRLLPQDPKKRASVRMISDLIAGGIQPLQNLSVLKQVGEEMQLTWAQNAITCGFN ALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVDLTPYPTISSINKRLLVLEAFQVSHPCRQPDT PTELRA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 17.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001504 |
Locus ID | 2954 |
UniProt ID | O43708 |
Cytogenetics | 14q24.3 |
Refseq Size | 1448 |
Refseq ORF | 486 |
Synonyms | GSTZ1-1; MAAI; MAI |
Summary | This gene is a member of the glutathione S-transferase (GSTs) super-family which encodes multifunctional enzymes important in the detoxification of electrophilic molecules, including carcinogens, mutagens, and several therapeutic drugs, by conjugation with glutathione. This enzyme catalyzes the conversion of maleylacetoacetate to fumarylacetoacatate, which is one of the steps in the phenylalanine/tyrosine degradation pathway. Deficiency of a similar gene in mouse causes oxidative stress. Several transcript variants of this gene encode multiple protein isoforms. [provided by RefSeq, Jul 2015] |
Protein Families | Druggable Genome |
Protein Pathways | Drug metabolism - cytochrome P450, Glutathione metabolism, Metabolic pathways, Metabolism of xenobiotics by cytochrome P450, Tyrosine metabolism |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
TP720541 | Recombinant protein of human glutathione transferase zeta 1 (GSTZ1), transcript variant 3 |
USD 330.00 |
|
TP761008 | Purified recombinant protein of Human glutathione transferase zeta 1 (GSTZ1), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.coli, 50ug |
USD 261.00 |
{0} Product Review(s)
Be the first one to submit a review