DUSP27 (DUPD1) (NM_001003892) Human Recombinant Protein
CAT#: TP314361
Recombinant protein of human dual specificity phosphatase and pro isomerase domain containing 1 (DUPD1), 20 µg
View other "DUSP27" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC214361 representing NM_001003892
Red=Cloning site Green=Tags(s) MTSGEVKTSLKNAYSSAKRLSPKMEEEGEEEDYCTPGAFELERLFWKGSPQYTHVNEVWPKLYIGDEATA LDRYRLQKAGFTHVLNAAHGRWNVDTGPDYYRDMDIQYHGVEADDLPTFDLSVFFYPAAAFIDRALSDDH SKILVHCVMGRSRSATLVLAYLMIHKDMTLVDAIQQVAKNRCVLPNRGFLKQLRELDKQLVQQRRRSQRQ DGEEEDGREL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 25.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001003892 |
Locus ID | 338599 |
UniProt ID | Q68J44 |
Cytogenetics | 10q22.2 |
Refseq Size | 663 |
Refseq ORF | 660 |
Synonyms | DUPD1; DUSP27; FMDSP |
Summary | Dual specificity phosphatase able to dephosphorylate phosphotyrosine, phosphoserine and phosphothreonine residues, with a preference for phosphotyrosine as a substrate.[UniProtKB/Swiss-Prot Function] |
Protein Families | Phosphatase |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424030 | DUPD1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY424030 | Transient overexpression lysate of dual specificity phosphatase and pro isomerase domain containing 1 (DUPD1) |
USD 436.00 |
|
PH314361 | DUPD1 MS Standard C13 and N15-labeled recombinant protein (NP_001003892) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review