DUSP27(DUPD1) (NM_001003892) Human Tagged ORF Clone

CAT#: RC214361

DUPD1 (Myc-DDK-tagged)-Human dual specificity phosphatase and pro isomerase domain containing 1 (DUPD1)

Clone Modification / Custom Cloning Service

USD 98.00

USD 390.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name DUSP27(DUPD1) (NM_001003892) Human Tagged ORF Clone
Symbol DUPD1
Synonyms DUSP27; FMDSP
Vector pCMV6-Entry
Sequence Data
>RC214361 representing NM_001003892
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACATCTGGAGAAGTGAAGACAAGCCTCAAGAATGCCTACTCATCTGCCAAGAGGCTGTCGCCGAAGA
TGGAGGAGGAAGGGGAGGAGGAGGACTACTGCACCCCTGGAGCCTTTGAGCTGGAGCGGCTCTTCTGGAA
GGGCAGTCCCCAGTACACCCACGTCAACGAGGTCTGGCCCAAGCTCTACATTGGCGATGAGGCGACGGCG
CTGGACCGCTATAGGCTGCAGAAGGCGGGGTTCACGCACGTGCTGAACGCGGCCCACGGCCGCTGGAACG
TGGACACTGGGCCCGACTACTACCGCGACATGGACATCCAGTACCACGGCGTGGAGGCCGACGACCTGCC
CACCTTCGACCTCAGTGTCTTCTTCTACCCGGCGGCAGCCTTCATCGACAGAGCGCTAAGCGACGACCAC
AGTAAGATCCTGGTTCACTGCGTCATGGGCCGCAGCCGGTCAGCCACCCTGGTCCTGGCCTACCTGATGA
TCCACAAGGACATGACCCTGGTGGACGCCATCCAGCAAGTGGCCAAGAACCGCTGCGTCCTCCCGAACCG
GGGCTTTTTGAAGCAGCTCCGGGAGCTGGACAAGCAGCTGGTGCAGCAGAGGCGACGGTCCCAGCGCCAG
GACGGTGAGGAGGAGGATGGCAGGGAGCTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC214361 representing NM_001003892
Red=Cloning site Green=Tags(s)

MTSGEVKTSLKNAYSSAKRLSPKMEEEGEEEDYCTPGAFELERLFWKGSPQYTHVNEVWPKLYIGDEATA
LDRYRLQKAGFTHVLNAAHGRWNVDTGPDYYRDMDIQYHGVEADDLPTFDLSVFFYPAAAFIDRALSDDH
SKILVHCVMGRSRSATLVLAYLMIHKDMTLVDAIQQVAKNRCVLPNRGFLKQLRELDKQLVQQRRRSQRQ
DGEEEDGREL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001003892
ORF Size 660 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001003892.1, NP_001003892
RefSeq Size 663
RefSeq ORF 663
Locus ID 338599
Cytogenetics 10q22.2
Protein Families Phosphatase
MW 25.2 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)