SDS3 (SUDS3) (NM_022491) Human Recombinant Protein
CAT#: TP310535
Recombinant protein of human suppressor of defective silencing 3 homolog (S. cerevisiae) (SUDS3), 20 µg
View other "SDS3" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210535 protein sequence
Red=Cloning site Green=Tags(s) MSAAGLLAPAPAQAGAPPAPEYYPEEDEELESAEDDERSCRGRESDEDTEDASETDLAKHDEEDYVEMKE QMYQDKLASLKRQLQQLQEGTLQEYQKRMKKLDQQYKERIRNAELFLQLETEQVERNYIKEKKAAVKEFE DKKVELKENLIAELEEKKKMIENEKLTMELTGDSMEVKPIMTRKLRRRPNDPVPIPDKRRKPAPAQLNYL LTDEQIMEDLRTLNKLKSPKRPASPSSPEHLPATPAESPAQRFEARIEDGKLYYDKRWYHKSQAIYLESK DNQKLSCVISSVGANEIWVRKTSDSTKMRIYLGQLQRGLFVIRRRSAA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 38 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_071936 |
Locus ID | 64426 |
UniProt ID | Q9H7L9 |
Cytogenetics | 12q24.23 |
Refseq Size | 4728 |
Refseq ORF | 984 |
Synonyms | SAP45; SDS3 |
Summary | SDS3 is a subunit of the histone deacetylase (see HDAC1; MIM 601241)-dependent SIN3A (MIM 607776) corepressor complex (Fleischer et al., 2003 [PubMed 12724404]).[supplied by OMIM, Mar 2008] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402929 | SUDS3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY402929 | Transient overexpression lysate of suppressor of defective silencing 3 homolog (S. cerevisiae) (SUDS3) |
USD 436.00 |
|
PH310535 | SUDS3 MS Standard C13 and N15-labeled recombinant protein (NP_071936) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review