RASL10A (NM_001007279) Human Recombinant Protein
CAT#: TP308743
Recombinant protein of human RAS-like, family 10, member A (RASL10A), transcript variant 2, 20 µg
View other "RASL10A" proteins (7)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208743 protein sequence
Red=Cloning site Green=Tags(s) MGGSLRVAVLGAPGVGKTAIIRQFLFGDYPERHRPTDGPRLYRPAVLLDGAVYDLSIRDGDVAGPGSSPG GPEEWPDAKDWSLQDTDAFVLVYDICSPDSFDYVKALRQRIAETR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 12.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001007280 |
Locus ID | 10633 |
UniProt ID | Q92737 |
Cytogenetics | 22q12.2 |
Refseq Size | 1813 |
Refseq ORF | 345 |
Synonyms | RRP22 |
Summary | Potent inhibitor of cellular proliferation.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416619 | RASL10A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC423485 | RASL10A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY416619 | Transient overexpression lysate of RAS-like, family 10, member A (RASL10A), transcript variant 1 |
USD 436.00 |
|
LY423485 | Transient overexpression lysate of RAS-like, family 10, member A (RASL10A), transcript variant 2 |
USD 436.00 |
|
PH305271 | RASL10A MS Standard C13 and N15-labeled recombinant protein (NP_006468) |
USD 3,255.00 |
|
PH308743 | RASL10A MS Standard C13 and N15-labeled recombinant protein (NP_001007280) |
USD 3,255.00 |
|
TP305271 | Recombinant protein of human RAS-like, family 10, member A (RASL10A), transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review