Alpha 1 microglobulin (AMBP) (NM_001633) Human Recombinant Protein
CAT#: TP308342
Recombinant protein of human alpha-1-microglobulin/bikunin precursor (AMBP), 20 µg
View other "Alpha 1 microglobulin" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208342 protein sequence
Red=Cloning site Green=Tags(s) MRSLGALLLLLSACLAVSAGPVPTPPDNIQVQENFNISRIYGKWYNLAIGSTCPWLKKIMDRMTVSTLVL GEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITMESYVVHTNYDEYAIFLTKKFSR HHGPTITAKLYGRAPQLRETLLQDFRVVAQGVGIPEDSIFTMADRGECVPGEQEPEPILIPRVRRAVLPQ EEEGSGGGQLVTEVTKKEDSCQLGYSAGPCMGMTSRYFYNGTSMACETFQYGGCMGNGNNFVTEKECLQT CRTVAACNLPIVRGPCRAFIQLWAFDAVKGKCVLFPYGGCQGNGNKFYSEKECREYCGVPGDGDEELLRF SN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 37.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001624 |
Locus ID | 259 |
UniProt ID | P02760 |
Cytogenetics | 9q32 |
Refseq Size | 1450 |
Refseq ORF | 1056 |
Synonyms | A1M; EDC1; HCP; HI30; IATIL; ITI; ITIL; ITILC; UTI |
Summary | This gene encodes a complex glycoprotein secreted in plasma. The precursor is proteolytically processed into distinct functioning proteins: alpha-1-microglobulin, which belongs to the superfamily of lipocalin transport proteins and may play a role in the regulation of inflammatory processes, and bikunin, which is a urinary trypsin inhibitor belonging to the superfamily of Kunitz-type protease inhibitors and plays an important role in many physiological and pathological processes. This gene is located on chromosome 9 in a cluster of lipocalin genes. [provided by RefSeq, Jul 2008] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400613 | AMBP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY400613 | Transient overexpression lysate of alpha-1-microglobulin/bikunin precursor (AMBP) |
USD 436.00 |
|
PH308342 | AMBP MS Standard C13 and N15-labeled recombinant protein (NP_001624) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review