SQSTM1 (NM_003900) Human Recombinant Protein

CAT#: TP303214L

Recombinant protein of human sequestosome 1 (SQSTM1), transcript variant 1, 1 mg

Size: 20 ug 100 ug 1 mg


Special Offer: Get a 20% discount on this product. Use code: "MVPro20".

USD 9,200.00

6 Weeks*

Size
    • 1 mg

Product Images

Frequently bought together (2)
SQSTM1 mouse monoclonal antibody, clone OTI1E9 (formerly 1E9)
    • 100 ul

USD 224.00 USD 447.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

USD 471.00

Other products for "SQSTM1"

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC203214 protein sequence
Red=Cloning site Green=Tags(s)

MASLTVKAYLLGKEDAAREIRRFSFCCSPEPEAEAEAAAGPGPCERLLSRVAALFPALRPGGFQAHYRDE
DGDLVAFSSDEELTMAMSYVKDDIFRIYIKEKKECRRDHRPPCAQEAPRNMVHPNVICDGCNGPVVGTRY
KCSVCPDYDLCSVCEGKGLHRGHTKLAFPSPFGHLSEGFSHSRWLRKVKHGHFGWPGWEMGPPGNWSPRP
PRAGEARPGPTAESASGPSEDPSVNFLKNVGESVAAALSPLGIEVDIDVEHGGKRSRLTPVSPESSSTEE
KSSSQPSSCCSDPSKPGGNVEGATQSLAEQMRKIALESEGRPEEQMESDNCSGGDDDWTHLSSKEVDPST
GELQSLQMPESEGPSSLDPSQEGPTGLKEAALYPHLPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTK
NYDIGAALDTIQYSKHPPPL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 47.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_003891
Locus ID 8878
UniProt ID Q13501
Cytogenetics 5q35.3
Refseq Size 2923
Refseq ORF 1320
Synonyms A170; DMRV; FTDALS3; NADGP; OSIL; p60; p62; p62B; PDB3; ZIP3
Summary This gene encodes a multifunctional protein that binds ubiquitin and regulates activation of the nuclear factor kappa-B (NF-kB) signaling pathway. The protein functions as a scaffolding/adaptor protein in concert with TNF receptor-associated factor 6 to mediate activation of NF-kB in response to upstream signals. Alternatively spliced transcript variants encoding either the same or different isoforms have been identified for this gene. Mutations in this gene result in sporadic and familial Paget disease of bone. [provided by RefSeq, Mar 2009]
Protein Families Druggable Genome, Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.