PAM16 (NM_016069) Human Recombinant Protein
CAT#: TP302828
Recombinant protein of humanmitochondria-associated protein involved in granulocyte-macrophage colony-stimulating factor signal transduction (Magmas), nuclear gene encoding mitochondrial, 20 µg
View other "PAM16" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202828 protein sequence
Red=Cloning site Green=Tags(s) MAKYLAQIIVMGVQVVGRAFARALRQEFAASRAAADARGRAGHRSAAASNLSGLSLQEAQQILNVSKLSP EEVQKNYEHLFKVNDKSVGGSFYLQSKVVRAKERLDEELKIQAQEDREKGQMPHT myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 13.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057153 |
Locus ID | 51025 |
UniProt ID | Q9Y3D7 |
Cytogenetics | 16p13.3 |
Refseq Size | 600 |
Refseq ORF | 375 |
Synonyms | CGI-136; MAGMAS; SMDMDM; TIM16; TIMM16 |
Summary | This gene encodes a mitochondrial protein involved in granulocyte-macrophage colony-stimulating factor (GM-CSF) signaling. This protein also plays a role in the import of nuclear-encoded mitochondrial proteins into the mitochondrial matrix and may be important in reactive oxygen species (ROS) homeostasis. Mutations in this gene cause Megarbane-Dagher-Melike type spondylometaphyseal dysplasia, an early lethal skeletal dysplasia characterized by short stature, developmental delay and other skeletal abnormalities. [provided by RefSeq, May 2017] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414208 | PAM16 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY414208 | Transient overexpression lysate of mitochondria-associated protein involved in granulocyte-macrophage colony-stimulating factor signal transduction (Magmas), nuclear gene encoding mitochondrial protein |
USD 436.00 |
|
PH302828 | TIMM16 MS Standard C13 and N15-labeled recombinant protein (NP_057153) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review