PAM16 (NM_016069) Human Recombinant Protein

CAT#: TP302828

Recombinant protein of humanmitochondria-associated protein involved in granulocyte-macrophage colony-stimulating factor signal transduction (Magmas), nuclear gene encoding mitochondrial, 20 µg

Product Images

Coomassie blue staining of purified PAM16 protein (Cat# TP302828). The protein was produced from HEK293T cells transfected with PAM16 cDNA clone (Cat# RC202828) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202828 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAKYLAQIIVMGVQVVGRAFARALRQEFAASRAAADARGRAGHRSAAASNLSGLSLQEAQQILNVSKLSP
  EEVQKNYEHLFKVNDKSVGGSFYLQSKVVRAKERLDEELKIQAQEDREKGQMPHT
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 13.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_057153
• Locus ID: 51025
• UniProt ID: Q9Y3D7
• Cytogenetics: 16p13.3
• Refseq Size: 600
• Refseq ORF: 375
• Synonyms: CGI-136; MAGMAS; SMDMDM; TIM16; TIMM16
• Summary: This gene encodes a mitochondrial protein involved in granulocyte-macrophage colony-stimulating factor (GM-CSF) signaling. This protein also plays a role in the import of nuclear-encoded mitochondrial proteins into the mitochondrial matrix and may be important in reactive oxygen species (ROS) homeostasis. Mutations in this gene cause Megarbane-Dagher-Melike type spondylometaphyseal dysplasia, an early lethal skeletal dysplasia characterized by short stature, developmental delay and other skeletal abnormalities. [provided by RefSeq, May 2017]