PAM16 (NM_016069) Human Mass Spec Standard

CAT#: PH302828

TIMM16 MS Standard C13 and N15-labeled recombinant protein (NP_057153)

Product Images

Coomassie blue staining of purified PAM16 protein (Cat# TP302828). The protein was produced from HEK293T cells transfected with PAM16 cDNA clone (Cat# RC202828) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202828
• Predicted MW: 13.8 kDa
• Protein Sequence:
  Sequence Link

  >RC202828 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAKYLAQIIVMGVQVVGRAFARALRQEFAASRAAADARGRAGHRSAAASNLSGLSLQEAQQILNVSKLSP
  EEVQKNYEHLFKVNDKSVGGSFYLQSKVVRAKERLDEELKIQAQEDREKGQMPHT
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057153
• RefSeq Size: 600
• RefSeq ORF: 375
• Synonyms: CGI-136; MAGMAS; SMDMDM; TIM16; TIMM16
• Locus ID: 51025
• UniProt ID: Q9Y3D7
• Cytogenetics: 16p13.3
• Summary: This gene encodes a mitochondrial protein involved in granulocyte-macrophage colony-stimulating factor (GM-CSF) signaling. This protein also plays a role in the import of nuclear-encoded mitochondrial proteins into the mitochondrial matrix and may be important in reactive oxygen species (ROS) homeostasis. Mutations in this gene cause Megarbane-Dagher-Melike type spondylometaphyseal dysplasia, an early lethal skeletal dysplasia characterized by short stature, developmental delay and other skeletal abnormalities. [provided by RefSeq, May 2017]