TTC1 (NM_003314) Human Recombinant Protein
CAT#: TP301690
Recombinant protein of human tetratricopeptide repeat domain 1 (TTC1), 20 µg
View other "TTC1" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201690 protein sequence
Red=Cloning site Green=Tags(s) MGEKSENCGVPEDLLNGLKVTDTQEAECAGPPVPDPKNQHSQSKLLRDDEAHLQEDQGEEECFHDCSASF EEEPGADKVENKSNEDVNSSELDEEYLIELKKNMSDEEKQKRREESTRLKEEGNEQFKKGDYIEAESSYS RALEMCPSCFQKERSILFSNRAAARMKQDKKEMAINDCSKAIQLNPSYIRAILRRAELYEKTDKLDEALE DYKSILEKDPSIHQAREACMRLPKQIEERNERLKEEMLGKLKDLGNLVLRPFGLSTENFQIKQDSSTGSY SINFVQNPNNNR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 33.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003305 |
Locus ID | 7265 |
UniProt ID | Q99614 |
Cytogenetics | 5q33.3 |
Refseq Size | 1500 |
Refseq ORF | 876 |
Synonyms | TPR1 |
Summary | This gene encodes a protein that belongs to the tetratrico peptide repeat superfamily of proteins. The encoded protein plays a role in protein-protein interactions, and binds to the Galpha subunit of G protein-coupled receptors to activate the Ras signaling pathway. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Sep 2013] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418776 | TTC1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY418776 | Transient overexpression lysate of tetratricopeptide repeat domain 1 (TTC1) |
USD 436.00 |
|
PH301690 | TTC1 MS Standard C13 and N15-labeled recombinant protein (NP_003305) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review