TTC1 (NM_003314) Human Recombinant Protein

CAT#: TP301690

Recombinant protein of human tetratricopeptide repeat domain 1 (TTC1), 20 µg

Product Images

Coomassie blue staining of purified TTC1 protein (Cat# TP301690). The protein was produced from HEK293T cells transfected with TTC1 cDNA clone (Cat# RC201690) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201690 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGEKSENCGVPEDLLNGLKVTDTQEAECAGPPVPDPKNQHSQSKLLRDDEAHLQEDQGEEECFHDCSASF
  EEEPGADKVENKSNEDVNSSELDEEYLIELKKNMSDEEKQKRREESTRLKEEGNEQFKKGDYIEAESSYS
  RALEMCPSCFQKERSILFSNRAAARMKQDKKEMAINDCSKAIQLNPSYIRAILRRAELYEKTDKLDEALE
  DYKSILEKDPSIHQAREACMRLPKQIEERNERLKEEMLGKLKDLGNLVLRPFGLSTENFQIKQDSSTGSY
  SINFVQNPNNNR
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 33.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_003305
• Locus ID: 7265
• UniProt ID: Q99614
• Cytogenetics: 5q33.3
• Refseq Size: 1500
• Refseq ORF: 876
• Synonyms: TPR1
• Summary: This gene encodes a protein that belongs to the tetratrico peptide repeat superfamily of proteins. The encoded protein plays a role in protein-protein interactions, and binds to the Galpha subunit of G protein-coupled receptors to activate the Ras signaling pathway. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Sep 2013]