OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TTC1 (NM_003314) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP301690
Recombinant protein of human tetratricopeptide repeat domain 1 (TTC1), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA307951 Rabbit polyclonal antibody to TTC1 (tetratricopeptide repeat domain 1)
100 ul
$665.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "TTC1 or NM_003314"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC201690 protein sequence
Red=Cloning site Green=Tags(s)

MGEKSENCGVPEDLLNGLKVTDTQEAECAGPPVPDPKNQHSQSKLLRDDEAHLQEDQGEEECFHDCSASF
EEEPGADKVENKSNEDVNSSELDEEYLIELKKNMSDEEKQKRREESTRLKEEGNEQFKKGDYIEAESSYS
RALEMCPSCFQKERSILFSNRAAARMKQDKKEMAINDCSKAIQLNPSYIRAILRRAELYEKTDKLDEALE
DYKSILEKDPSIHQAREACMRLPKQIEERNERLKEEMLGKLKDLGNLVLRPFGLSTENFQIKQDSSTGSY
SINFVQNPNNNR

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 33.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_003305
Locus ID 7265
UniProt ID Q99614
Cytogenetics 5q33.3
RefSeq Size 1500
RefSeq ORF 876
Synonyms TPR1
Summary This gene encodes a protein that belongs to the tetratrico peptide repeat superfamily of proteins. The encoded protein plays a role in protein-protein interactions, and binds to the Galpha subunit of G protein-coupled receptors to activate the Ras signaling pathway. Alternate splicing results in multiple transcript variants. provided by RefSeq, Sep 2013
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TTC1" proteins (3)
SKU Description Size Price
PH301690 TTC1 MS Standard C13 and N15-labeled recombinant protein (NP_003305) 10 ug
$3,360.00
LC418776 Lyophilized TTC1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418776 Transient overexpression lysate of tetratricopeptide repeat domain 1 (TTC1) (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products