OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

KCNE2 (NM_172201) Human Mass Spec Standard

Be the first to review this product
SKU
PH311320
KCNE2 MS Standard C13 and N15-labeled recombinant protein (NP_751951)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA361228 KCNE2 Antibody - middle region
100 ul
$585.00
LY403536 Transient overexpression lysate of potassium voltage-gated channel, Isk-related family, member 2 (KCNE2) (as WB positive control) 100 ug
$436.00

Other products for "KCNE2 or NM_172201"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC211320
Predicted MW 14.5 kDa
Protein Sequence
Protein Sequence
>RC211320 protein sequence
Red=Cloning site Green=Tags(s)

MSTLSNFTQTLEDVFRRIFITYMDNWRQNTTAEQEALQAKVDAENFYYVILYLMVMIGMFSFIIVAILVS
TVKSKRREHSNDPYHQYIVEDWQEKYKSQILNLEESKATIHENIGAAGFKMSP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_751951
RefSeq Size 809
RefSeq ORF 369
Synonyms ATFB4; LQT5; LQT6; MIRP1
Locus ID 9992
UniProt ID Q9Y6J6
Cytogenetics 21q22.11
Summary Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, isk-related subfamily. This member is a small integral membrane subunit that assembles with the KCNH2 gene product, a pore-forming protein, to alter its function. This gene is expressed in heart and muscle and the gene mutations are associated with cardiac arrhythmia. provided by RefSeq, Jul 2008
Protein Families Druggable Genome, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "KCNE2" proteins (3)
SKU Description Size Price
LC403536 Lyophilized KCNE2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403536 Transient overexpression lysate of potassium voltage-gated channel, Isk-related family, member 2 (KCNE2) (as WB positive control) 100 ug
$436.00
TP311320 Recombinant protein of human potassium voltage-gated channel, Isk-related family, member 2 (KCNE2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products