GM CSF (CSF2) (NM_000758) Human Mass Spec Standard
CAT#: PH311109
CSF2 MS Standard C13 and N15-labeled recombinant protein (NP_000749)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC211109 |
Predicted MW | 16.3 kDa |
Protein Sequence |
>RC211109 protein sequence
Red=Cloning site Green=Tags(s) MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPT CLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWE PVQE myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_000749 |
RefSeq Size | 800 |
RefSeq ORF | 432 |
Synonyms | CSF; GMCSF |
Locus ID | 1437 |
UniProt ID | P04141 |
Cytogenetics | 5q31.1 |
Summary | The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of granulocytes and macrophages. The active form of the protein is found extracellularly as a homodimer. This gene has been localized to a cluster of related genes at chromosome region 5q31, which is known to be associated with interstitial deletions in the 5q- syndrome and acute myelogenous leukemia. Other genes in the cluster include those encoding interleukins 4, 5, and 13. This gene plays a role in promoting tissue inflammation. Elevated levels of cytokines, including the one produced by this gene, have been detected in SARS-CoV-2 infected patients that develop acute respiratory distress syndrome. Mice deficient in this gene or its receptor develop pulmonary alveolar proteinosis. [provided by RefSeq, Aug 2020] |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein |
Protein Pathways | Cytokine-cytokine receptor interaction, Fc epsilon RI signaling pathway, Hematopoietic cell lineage, Jak-STAT signaling pathway, Natural killer cell mediated cytotoxicity, T cell receptor signaling pathway |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400257 | CSF2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY400257 | Transient overexpression lysate of colony stimulating factor 2 (granulocyte-macrophage) (CSF2) |
USD 436.00 |
|
TP311109 | Recombinant protein of human colony stimulating factor 2 (granulocyte-macrophage) (CSF2), 20 µg |
USD 867.00 |
|
TP720003 | Recombinant protein of human colony stimulating factor 2 (granulocyte-macrophage) (CSF2) |
USD 330.00 |
|
TP720031 | Recombinant protein of human colony stimulating factor 2 (granulocyte-macrophage) (CSF2) |
USD 330.00 |
|
TP721106 | Purified recombinant protein of Human colony stimulating factor 2 (granulocyte-macrophage) (CSF2) |
USD 330.00 |
|
TP723720 | Purified recombinant protein of Human colony stimulating factor 2 (granulocyte-macrophage) (CSF2) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review