TMEM17 (NM_198276) Human Mass Spec Standard
CAT#: PH308232
TMEM17 MS Standard C13 and N15-labeled recombinant protein (NP_938017)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208232 |
Predicted MW | 23.1 kDa |
Protein Sequence |
>RC208232 protein sequence
Red=Cloning site Green=Tags(s) MELPDPVRQRLGNFSRAVFSDSNRTSPESNEGPENEMVSSLALQMSLYFNTYYFPLWWVSSIMMLHMKYS ILPDYYKFIVITVIILITLIEAIRLYLGYVGNLQEKVPELAGFWLLSLLLQLPLILFLLFNEGLTNLPLE KAIHIIFTLFLAFQVVAAFLTLRKMVNQLAVRFHLQDFDRLSANRGDMRRMRSCIEEI myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_938017 |
RefSeq Size | 1925 |
RefSeq ORF | 594 |
Locus ID | 200728 |
UniProt ID | Q86X19 |
Cytogenetics | 2p15 |
Summary | Transmembrane component of the tectonic-like complex, a complex localized at the transition zone of primary cilia and acting as a barrier that prevents diffusion of transmembrane proteins between the cilia and plasma membranes. Required for ciliogenesis and sonic hedgehog/SHH signaling (By similarity).[UniProtKB/Swiss-Prot Function] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405002 | TMEM17 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY405002 | Transient overexpression lysate of transmembrane protein 17 (TMEM17) |
USD 436.00 |
|
TP308232 | Recombinant protein of human transmembrane protein 17 (TMEM17), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review