TMEM17 (NM_198276) Human Tagged ORF Clone

CAT#: RC208232

TMEM17 (Myc-DDK-tagged)-Human transmembrane protein 17 (TMEM17)

Clone Modification / Custom Cloning Service

USD 98.00

USD 390.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name TMEM17 (NM_198276) Human Tagged ORF Clone
Symbol TMEM17
Synonyms FLJ34583
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC208232 representing NM_198276
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGCTGCCAGATCCGGTGCGCCAGCGGCTGGGAAACTTCAGCCGGGCCGTGTTCAGTGATTCCAATC
GGACCAGTCCAGAGTCCAATGAGGGTCCGGAAAATGAAATGGTCTCCAGTTTGGCACTGCAGATGTCACT
TTATTTTAATACCTACTATTTCCCACTGTGGTGGGTGAGCAGCATTATGATGCTTCACATGAAGTATTCA
ATCTTGCCTGACTACTACAAATTCATTGTGATCACTGTTATCATCCTAATAACCTTAATTGAAGCCATCC
GGTTGTATCTGGGCTACGTGGGTAACCTACAGGAGAAGGTTCCTGAGTTGGCTGGCTTTTGGCTTTTGAG
CCTTCTATTGCAGTTACCTTTAATTCTTTTCTTGCTCTTTAATGAAGGCCTAACAAATCTGCCCTTGGAA
AAAGCGATACATATCATCTTCACTCTCTTCCTTGCTTTCCAAGTTGTTGCAGCATTTCTTACCTTAAGGA
AAATGGTTAATCAGTTGGCAGTTCGTTTCCACCTCCAAGACTTTGACCGGCTCTCTGCAAACAGAGGAGA
CATGAGAAGGATGAGGTCATGTATAGAAGAGATC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC208232 representing NM_198276
Red=Cloning site Green=Tags(s)

MELPDPVRQRLGNFSRAVFSDSNRTSPESNEGPENEMVSSLALQMSLYFNTYYFPLWWVSSIMMLHMKYS
ILPDYYKFIVITVIILITLIEAIRLYLGYVGNLQEKVPELAGFWLLSLLLQLPLILFLLFNEGLTNLPLE
KAIHIIFTLFLAFQVVAAFLTLRKMVNQLAVRFHLQDFDRLSANRGDMRRMRSCIEEI

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_198276
ORF Size 594 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_198276.1, NM_198276.2, NP_938017
RefSeq Size 1407
RefSeq ORF 597
Locus ID 200728
Cytogenetics 2p15
Protein Families Transmembrane
MW 22.9 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations