CAMK1D (NM_153498) Human Mass Spec Standard
CAT#: PH307736
CAMK1D MS Standard C13 and N15-labeled recombinant protein (NP_705718)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207736 |
Predicted MW | 42.9 kDa |
Protein Sequence |
>RC207736 protein sequence
Red=Cloning site Green=Tags(s) MARENGESSSSWKKQAEDIKKIFEFKETLGTGAFSEVVLAEEKATGKLFAVKCIPKKALKGKESSIENEI AVLRKIKHENIVALEDIYESPNHLYLVMQLVSGGELFDRIVEKGFYTEKDASTLIRQVLDAVYYLHRMGI VHRDLKPENLLYYSQDEESKIMISDFGLSKMEGKGDVMSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVI AYILLCGYPPFYDENDSKLFEQILKAEYEFDSPYWDDISDSAKDFIRNLMEKDPNKRYTCEQAARHPWIA GDTALNKNIHESVSAQIRKNFAKSKWRQAFNATAVVRHMRKLHLGSSLDSSNASVSSSLSLASQKDCLAP STLCSFISSSSGVSGVGAERRPRPTTVTAVHSGSK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_705718 |
RefSeq Size | 2242 |
RefSeq ORF | 1155 |
Synonyms | CaM-K1; CaMKID; CKLiK |
Locus ID | 57118 |
UniProt ID | Q8IU85, Q5SQQ7 |
Cytogenetics | 10p13 |
Summary | This gene is a member of the calcium/calmodulin-dependent protein kinase 1 family, a subfamily of the serine/threonine kinases. The encoded protein is a component of the calcium-regulated calmodulin-dependent protein kinase cascade. It has been associated with multiple processes including regulation of granulocyte function, activation of CREB-dependent gene transcription, aldosterone synthesis, differentiation and activation of neutrophil cells, and apoptosis of erythroleukemia cells. Alternatively spliced transcript variants encoding different isoforms of this gene have been described. [provided by RefSeq, Jan 2015] |
Protein Families | Druggable Genome, Protein Kinase |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407015 | CAMK1D HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC412500 | CAMK1D HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC429619 | CAMK1D HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY407015 | Transient overexpression lysate of calcium/calmodulin-dependent protein kinase ID (CAMK1D), transcript variant 2 |
USD 436.00 |
|
LY412500 | Transient overexpression lysate of calcium/calmodulin-dependent protein kinase ID (CAMK1D), transcript variant 1 |
USD 436.00 |
|
TP307736 | Recombinant protein of human calcium/calmodulin-dependent protein kinase ID (CAMK1D), transcript variant 2, 20 µg |
USD 867.00 |
|
TP721028 | Purified recombinant protein of Human calcium/calmodulin-dependent protein kinase ID (CAMK1D), transcript variant 2 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review