CAMK1D (NM_153498) Human Mass Spec Standard

CAT#: PH307736

CAMK1D MS Standard C13 and N15-labeled recombinant protein (NP_705718)

Product Images

Coomassie blue staining of purified CAMK1D protein (Cat# TP307736). The protein was produced from HEK293T cells transfected with CAMK1D cDNA clone (Cat# RC207736) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207736
• Predicted MW: 42.9 kDa
• Protein Sequence:
  Sequence Link

  >RC207736 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MARENGESSSSWKKQAEDIKKIFEFKETLGTGAFSEVVLAEEKATGKLFAVKCIPKKALKGKESSIENEI
  AVLRKIKHENIVALEDIYESPNHLYLVMQLVSGGELFDRIVEKGFYTEKDASTLIRQVLDAVYYLHRMGI
  VHRDLKPENLLYYSQDEESKIMISDFGLSKMEGKGDVMSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVI
  AYILLCGYPPFYDENDSKLFEQILKAEYEFDSPYWDDISDSAKDFIRNLMEKDPNKRYTCEQAARHPWIA
  GDTALNKNIHESVSAQIRKNFAKSKWRQAFNATAVVRHMRKLHLGSSLDSSNASVSSSLSLASQKDCLAP
  STLCSFISSSSGVSGVGAERRPRPTTVTAVHSGSK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_705718
• RefSeq Size: 2242
• RefSeq ORF: 1155
• Synonyms: CaM-K1; CaMKID; CKLiK
• Locus ID: 57118
• UniProt ID: Q8IU85, Q5SQQ7
• Cytogenetics: 10p13
• Summary: This gene is a member of the calcium/calmodulin-dependent protein kinase 1 family, a subfamily of the serine/threonine kinases. The encoded protein is a component of the calcium-regulated calmodulin-dependent protein kinase cascade. It has been associated with multiple processes including regulation of granulocyte function, activation of CREB-dependent gene transcription, aldosterone synthesis, differentiation and activation of neutrophil cells, and apoptosis of erythroleukemia cells. Alternatively spliced transcript variants encoding different isoforms of this gene have been described. [provided by RefSeq, Jan 2015]
• Protein Families: Druggable Genome, Protein Kinase