CAMK1D (NM_153498) Human Recombinant Protein

CAT#: TP721028

Reviews ()
Write a review

Purified recombinant protein of Human calcium/calmodulin-dependent protein kinase ID (CAMK1D), transcript variant 2



  View other "CAMK1D" proteins (8)

USD 300.00


Availability*
2 Weeks

Size
    • 10 ug


Product images

Specifications

Product Data
Description Purified recombinant protein of Human calcium/calmodulin-dependent protein kinase ID (CAMK1D), transcript variant 2
Species Human
Expression Host E. coli
Expression cDNA Clone or AA Sequence MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSMARENGESSSSWKKQAEDIKKIFEFKETL
Tag N-GST
Predicted MW 69.2 kDa
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Supplied as a 0.2 µM filtered solution of PBS, pH 7.4
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Storage Store at -80°C.
Stability Stable for at least 3 months from date of receipt under proper storage and handling conditions.
Reference Data
RefSeq NP_705718
Locus ID 57118
Refseq Size 2242
Cytogenetics 10p13
Refseq ORF 1155
Synonyms CaM-K1; CaMKID; CKLiK
Summary This gene is a member of the calcium/calmodulin-dependent protein kinase 1 family, a subfamily of the serine/threonine kinases. The encoded protein is a component of the calcium-regulated calmodulin-dependent protein kinase cascade. It has been associated with multiple processes including regulation of granulocyte function, activation of CREB-dependent gene transcription, aldosterone synthesis, differentiation and activation of neutrophil cells, and apoptosis of erythroleukemia cells. Alternatively spliced transcript variants encoding different isoforms of this gene have been described. [provided by RefSeq, Jan 2015]
Protein Families Druggable Genome, Protein Kinase

Documents

Other Versions

Other products for "CAMK1D"
Frequently bought together (1)
Anti-CAMK1D mouse monoclonal antibody, clone OTI2C6 (formerly 2C6)
    • 100 ul

USD 379.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools
HUMAN PROREINS 101