FAM136A (NM_032822) Human Mass Spec Standard

CAT#: PH304914

FAM136A MS Standard C13 and N15-labeled recombinant protein (NP_116211)

Product Images

Coomassie blue staining of purified FAM136A protein (Cat# TP304914). The protein was produced from HEK293T cells transfected with FAM136A cDNA clone (Cat# RC204914) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204914
• Predicted MW: 15.6 kDa
• Protein Sequence:
  Sequence Link

  >RC204914 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAELQQLRVQEAVESMVKSLERENIRKMQGLMFRCSASCCEDSQASMKQVHQCIERCHVPLAQAQALVTS
  ELEKFQDRLARCTMHCNDKAKDSIDAGSKELQVKQQLDSCVTKCVDDHMHLIPTMTKKMKEALLSIGK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_116211
• RefSeq Size: 1824
• RefSeq ORF: 414
• Locus ID: 84908
• UniProt ID: Q96C01
• Cytogenetics: 2p13.3
• Summary: This gene encodes a mitochondrially localized protein that is highly conserved across species. The gene is expressed in a variety of tissues including human lymphoblast cells and rat neurosensorial epithelium of the cristaampullaris. A mutation in this gene has been associated with familial Meniere's disease, a chronic disorder of the inner ear. Several pseudogenes of this gene are found on other chromosomes. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2016]