AK3 (NM_016282) Human Mass Spec Standard
CAT#: PH304408
AK3 MS Standard C13 and N15-labeled recombinant protein (NP_057366)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204408 |
Predicted MW | 25.6 kDa |
Protein Sequence |
>RC204408 protein sequence
Red=Cloning site Green=Tags(s) MGASARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGTEIGVLAKAFIDQGKLIPDDV MTRLALHELKNLTQYSWLLDGFPRTLPQAEALDRAYQIDTVINLNVPFEVIKQRLTARWIHPASGRVYNI EFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLKAYEDQTKPVLEYYQKKGVLETFSGTETNKIWPYVYA FLQTKVPQRSQKASVTP myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_057366 |
RefSeq Size | 4333 |
RefSeq ORF | 681 |
Synonyms | AK3L1; AK6; AKL3L; AKL3L1; FIX |
Locus ID | 50808 |
UniProt ID | Q9UIJ7, Q7Z4Y4 |
Cytogenetics | 9p24.1 |
Summary | The protein encoded by this gene is a GTP:ATP phosphotransferase that is found in the mitochondrial matrix. Several transcript variants encoding a few different isoforms have been found for this gene. [provided by RefSeq, Dec 2010] |
Protein Families | Druggable Genome |
Protein Pathways | Pyrimidine metabolism |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414079 | AK3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY414079 | Transient overexpression lysate of adenylate kinase 3 (AK3), nuclear gene encoding mitochondrial protein |
USD 436.00 |
|
TP304408 | Recombinant protein of human adenylate kinase 3 (AK3), nuclear gene encoding mitochondrial protein, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review