AK3 (NM_016282) Human Recombinant Protein

CAT#: TP304408M

Recombinant protein of human adenylate kinase 3 (AK3), nuclear gene encoding mitochondrial protein, 100 µg

Product Images

Coomassie blue staining of purified AK3 protein (Cat# TP304408). The protein was produced from HEK293T cells transfected with AK3 cDNA clone (Cat# RC204408) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204408 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGASARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGTEIGVLAKAFIDQGKLIPDDV
  MTRLALHELKNLTQYSWLLDGFPRTLPQAEALDRAYQIDTVINLNVPFEVIKQRLTARWIHPASGRVYNI
  EFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLKAYEDQTKPVLEYYQKKGVLETFSGTETNKIWPYVYA
  FLQTKVPQRSQKASVTP
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 25.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_057366
• Locus ID: 50808
• UniProt ID: Q9UIJ7, Q7Z4Y4
• Cytogenetics: 9p24.1
• Refseq Size: 4333
• Refseq ORF: 681
• Synonyms: AK3L1; AK6; AKL3L; AKL3L1; FIX
• Summary: The protein encoded by this gene is a GTP:ATP phosphotransferase that is found in the mitochondrial matrix. Several transcript variants encoding a few different isoforms have been found for this gene. [provided by RefSeq, Dec 2010]
• Protein Families: Druggable Genome
• Protein Pathways: Pyrimidine metabolism