C9orf80 (INIP) (NM_021218) Human Mass Spec Standard

CAT#: PH302357

C9orf80 MS Standard C13 and N15-labeled recombinant protein (NP_067041)

Product Images

Coomassie blue staining of purified INIP protein (Cat# TP302357). The protein was produced from HEK293T cells transfected with INIP cDNA clone (Cat# RC202357) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202357
• Predicted MW: 11.4 kDa
• Protein Sequence:
  Sequence Link

  >RC202357 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAANSSGQGFQNKNRVAILAELDKEKRKLLMQNQSSTNHPGASIALSRPSLNKDFRDHAEQQHIAAQQKA
  ALQHAHAHSSGYFITQDSAFGNLILPVLPRLDPE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_067041
• RefSeq Size: 1532
• RefSeq ORF: 312
• Synonyms: C9orf80; HSPC043; hSSBIP1; MISE; SOSSC; SSBIP1
• Locus ID: 58493
• UniProt ID: Q9NRY2
• Cytogenetics: 9q32
• Summary: The protein encoded by this gene is a subunit of single-stranded DNA binding complexes that are important for maintaining genome stability. These complexes are involved in G2/M checkpoint control and homologous recombination repair. [provided by RefSeq, Jul 2016]