C9orf80 (INIP) (NM_021218) Human Recombinant Protein
CAT#: TP302357
Recombinant protein of human chromosome 9 open reading frame 80 (C9orf80), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202357 protein sequence
Red=Cloning site Green=Tags(s) MAANSSGQGFQNKNRVAILAELDKEKRKLLMQNQSSTNHPGASIALSRPSLNKDFRDHAEQQHIAAQQKA ALQHAHAHSSGYFITQDSAFGNLILPVLPRLDPE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 11.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_067041 |
Locus ID | 58493 |
UniProt ID | Q9NRY2 |
Cytogenetics | 9q32 |
Refseq Size | 1532 |
Refseq ORF | 312 |
Synonyms | C9orf80; HSPC043; hSSBIP1; MISE; SOSSC; SSBIP1 |
Summary | The protein encoded by this gene is a subunit of single-stranded DNA binding complexes that are important for maintaining genome stability. These complexes are involved in G2/M checkpoint control and homologous recombination repair. [provided by RefSeq, Jul 2016] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412020 | INIP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY412020 | Transient overexpression lysate of chromosome 9 open reading frame 80 (C9orf80) |
USD 436.00 |
|
PH302357 | C9orf80 MS Standard C13 and N15-labeled recombinant protein (NP_067041) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review