CIRBP (NM_001280) Human Mass Spec Standard

CAT#: PH301639

CIRBP MS Standard C13 and N15-labeled recombinant protein (NP_001271)

Product Images

Coomassie blue staining of purified CIRBP protein (Cat# TP301639). The protein was produced from HEK293T cells transfected with CIRBP cDNA clone (Cat# RC201639) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201639
• Predicted MW: 18.6 kDa
• Protein Sequence:
  Sequence Link

  >RC201639 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGK
  SVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRGFSRGGGDRGYGGNRFESRSGGYGGSRD
  YYSSRSQSGGYSDRSSGGSYRDSYDSYATHNE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001271
• RefSeq Size: 1397
• RefSeq ORF: 516
• Synonyms: CIRP
• Locus ID: 1153
• UniProt ID: Q14011, Q53XX5
• Cytogenetics: 19p13.3
• Summary: Cold-inducible mRNA binding protein that plays a protective role in the genotoxic stress response by stabilizing transcripts of genes involved in cell survival. Acts as a translational activator. Seems to play an essential role in cold-induced suppression of cell proliferation. Binds specifically to the 3'-untranslated regions (3' UTRs) of stress-responsive transcripts RPA2 and TXN. Acts as a translational repressor (By similarity). Promotes assembly of stress granules (SGs), when overexpressed.[UniProtKB/Swiss-Prot Function]