Grin2a (NM_012573) Rat Tagged ORF Clone

CAT#: RR214669

Grin2a (Myc-DDK-tagged ORF) - Rat glutamate receptor, ionotropic, N-methyl D-aspartate 2A (Grin2a), (10 ug)

Change vector?

  • TrueORF®

USD 2,328.00


Availability*
6 Weeks

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Grin2a (NM_012573) Rat Tagged ORF Clone
Symbol Grin2a
Synonyms GluN2A; NMDAR2A; NR2A
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RR214669 representing NM_012573
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCAGATTGGGCTACTGGACCTTGCTGGTATTGCCGGCCCTTCTGGTCTGGCGCGATCCGGCGCAGA
ACGCGGCGGCGGAGAAGGGTCCTCCAGCGCTGAACATTGCGGTGCTGCTGGGTCACAGCCACGACGTGAC
AGAACGCGAACTTCGAAATCTGTGGGGCCCAGAGCAGGCAACCGGCTTGCCCCTGGATGTGAACGTGGTG
GCGTTATTGATGAACCGCACTGACCCTAAGAGCCTCATCACGCATGTGTGCGACCTCATGTCCGGGGCGC
GCATCCACGGCTTGGTGTTTGGAGATGACACGGACCAGGAGGCTGTGGCCCAGATGCTGGATTTTATCTC
CTCACAGACTTTTATCCCCATCTTGGGCATTCATGGGGGTGCATCTATGATCATGGCTGACAAGGATCCG
ACATCCACGTTCTTCCAGTTTGGAGCCTCCATCCAGCAGCAAGCCACAGTTATGCTGAAGATCATGCAGG
ACTACGACTGGCACGTCTTCTCCCTGGTCACCACCATCTTCCCTGGCTACCGAGACTTCATCAGCTTTAT
CAAGACAACAGTGGACAACAGCTTTGTGGGCTGGGATATGCAGAACGTGATCACACTGGACACCTCCTTC
GAGGACGCCAAGACGCAGGTCCAGCTGAAGAAGATCCATTCTTCTGTCATCCTGCTCTACTGCTCCAAAG
ACGAGGCTGTCCTCATCCTGAGCGAGGCTCGCTCCCTCGGCCTCACTGGCTATGATTTCTTCTGGATTGT
CCCCAGTTTGGTGTCTGGGAACACAGAGCTCATCCCCAAAGAGTTTCCATCAGGTCTCATTTCAGTCTCT
TATGACGACTGGGACTACAGCCTGGAGGCAAGAGTGAGAGACGGTCTTGGGATCTTAACCACTGCCGCAT
CCTCCATGTTGGAGAAGTTCTCCTACATTCCTGAGGCCAAGGCCAGCTGCTATGGGCAGGCAGAGAAGCC
AGAGACCCCGCTACACACCCTGCACCAATTCATGGTCAATGTGACTTGGGATGGCAAGGACTTGTCCTTC
ACTGAGGAAGGTTACCAGGTGCACCCCAGGCTTGTGGTGATCGTGCTGAACAAGGACCGGGAGTGGGAAA
AGGTGGGCAAGTGGGAGAACCAGACGCTGAGCCTGAGGCACGCTGTGTGGCCAAGGTACAAGTCCTTTTC
TGACTGCGAGCCAGATGACAACCACCTCAGCATTGTCACCTTGGAGGAAGCCCCCTTCGTCATCGTAGAG
GACATAGACCCCCTGACTGAGACCTGTGTGAGGAACACGGTGCCCTGTCGGAAGTTCGTCAAGATCAACA
ATTCAACCAACGAAGGGATGAATGTGAAGAAATGCTGCAAGGGGTTCTGCATCGACATCCTCAAGAAGCT
GTCCAGAACTGTGAAGTTCACCTATGACCTCTACCTGGTGACCAATGGGAAGCATGGGAAAAAGGTTAAC
AATGTGTGGAATGGAATGATAGGTGAAGTGGTCTATCAACGAGCAGTCATGGCTGTGGGCTCACTCACCA
TCAATGAGGAGCGTTCGGAAGTGGTGGACTTCTCGGTGCCCTTCGTGGAGACAGGAATCAGCGTCATGGT
CTCCAGGAGTAATGGCACTGTCTCCCCTTCTGCTTTCCTCGAACCCTTCAGTGCCTCCGTCTGGGTGATG
ATGTTTGTGATGCTGCTCATCGTCTCAGCCATTGCTGTCTTCGTTTTTGAATACTTCAGTCCTGTTGGAT
ACAACAGAAACTTAGCCAAAGGGAAAGCTCCCCACGGGCCTTCTTTTACTATTGGAAAAGCTATATGGCT
CCTCTGGGGCCTGGTCTTCAACAATTCTGTGCCTGTCCAGAATCCTAAAGGCACAACCAGCAAGATCATG
GTGTCAGTGTGGGCCTTCTTTGCTGTCATCTTCCTGGCCAGTTACACAGCCAACCTGGCTGCCTTCATGA
TCCAGGAGGAGTTTGTGGACCAAGTGACTGGCCTCAGTGACAAGAAGTTCCAGAGACCTCATGACTATTC
TCCACCTTTCCGATTTGGGACGGTACCCAATGGAAGTACAGAGAGGAATATTCGTAACAACTACCCGTAT
ATGCACCAGTACATGACCAGATTCAACCAGAGGGGAGTGGAGGATGCCTTGGTCAGCTTGAAAACCGGGA
AGTTGGACGCTTTCATCTATGACGCAGCCGTCTTGAACTACAAGGCCGGGAGGGATGAAGGCTGTAAACT
GGTGACCATTGGGAGCGGGTACATCTTTGCTACCACAGGCTATGGAATTGCGCTGCAGAAGGGCTCACCC
TGGAAGAGGCAGATTGACCTCGCTCTGCTCCAGTTTGTTGGTGATGGTGAGATGGAGGAGCTGGAGACAC
TGTGGCTTACGGGCATCTGCCACAACGAGAAGAATGAGGTGATGAGTAGCCAGCTGGACATCGATAACAT
GGCGGGCGTGTTCTACATGCTGGCTGCAGCCATGGCCCTCAGCCTCATCACCTTCATCTGGGAGCACCTC
TTCTACTGGAAGCTGCGCTTCTGCTTCACAGGCGTGTGCTCTGACCGGCCCGGGCTGCTCTTCTCCATCA
GCAGGGGCATCTATAGTTGCATCCATGGGGTACACATTGAAGAAAAGAAGAAATCTCCAGATTTCAATCT
GACTGGATCACAGAGCAACATGCTAAAGCTTCTTCGGTCAGCTAAAAACATCTCCAATATGTCCAACATG
AACTCCTCAAGAATGGACTCACCTAAAAGAGCTACTGACTTCATTCAAAGAGGGTCACTTATTGTGGACA
TGGTTTCAGACAAGGGAAATTTGATATATTCAGACAACAGATCCTTTCAAGGGAAGGACAGTATATTTGG
AGACAACATGAATGAACTCCAAACATTTGTGGCCAACAGGCACAAGGATAATCTCAGTAACTATGTGTTT
CAAGGACAGCATCCTCTCACTCTCAATGAGTCCAACCCTAACACAGTAGAGGTGGCTGTCAGCACTGAAT
CCAAAGGGAACTCCCGACCCCGGCAGCTTTGGAAGAAATCCATGGAGTCTCTACGCCAGGATTCTCTAAA
CCAGAACCCAGTCTCCCAGAGGGATGAGAAGACTGCAGAGAATCGGACCCACTCGCTAAAGAGTCCTAGG
TATCTTCCAGAAGAGGTAGCCCACTCTGACATTTCAGAAACCTCAAGCCGGGCCACATGCCACAGGGAGC
CAGATAACAATAAGAACCACAAGACCAAGGATAACTTCAAACGGTCAATGGCCTCTAAGTATCCCAAGGA
CTGTAGCGATGTTGACCGCACCTACATGAAAACCAAAGCAAGTTCTCCCAGGGATAAGATCTATACCATT
GATGGTGAGAAGGAGCCCAGCTTCCACTTAGATCCTCCTCAGTTTGTTGAGAATATAACCCTGCCTGAGA
ATGTGGGCTTCCCAGATACCTACCAAGATCACAATGAGAACTTCCGCAAGGGGGACTCCACACTGCCCAT
GAACAGGAACCCATTACATAATGAAGACGGGCTTCCCAACAATGACCAATATAAACTCTATGCCAAGCAC
TTTACCTTGAAAGACAAGGGTTCCCCACACAGTGAGGGCAGTGATCGATACCGGCAGAACTCCACACATT
GCAGAAGCTGCCTTTCGAATCTGCCCACCTACTCAGGCCACTTTACCATGAGGTCTCCTTTCAAGTGTGA
TGCCTGTCTGCGGATGGGGAATCTCTATGACATTGATGAAGACCAGATGCTTCAGGAGACAGGTAACCCA
GCTACTCGGGAGGAGGTCTACCAGCAGGACTGGTCACAGAACAACGCCCTCCAGTTCCAGAAGAACAAGC
TAAGGATTAACCGACAGCACTCCTATGATAACATTCTGGACAAACCCAGAGAGATAGACCTTAGCAGGCC
CTCCCGGAGCATAAGCCTCAAGGACAGGGAACGGCTACTGGAGGGCAACTTGTATGGGAGCCTGTTCAGT
GTCCCCTCAAGCAAACTCTTGGGGAACAAAAGCTCCCTTTTCCCCCAAGGTCTGGAGGACAGCAAGAGGA
GCAAGTCTCTCTTGCCAGACCACGCCTCCGATAATCCTTTCCTCCACACGTATGGGGATGACCAACGCTT
AGTTATCGGGAGATGTCCCTCGGACCCTTACAAACACTCATTGCCATCACAGGCGGTAAATGACAGCTAT
CTTCGGTCATCCTTGAGGTCAACAGCATCATATTGCTCCAGGGACAGTCGGGGCCACAGTGATGTGTATA
TTTCAGAGCATGTTATGCCTTATGCTGCAAATAAGAATACCATGTACTCTACCCCCAGGGTTTTAAATTC
CTGCAGCAATAGACGAGTGTACAAGAAAATGCCTAGTATCGAATCTGATGTT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RR214669 representing NM_012573
Red=Cloning site Green=Tags(s)

MGRLGYWTLLVLPALLVWRDPAQNAAAEKGPPALNIAVLLGHSHDVTERELRNLWGPEQATGLPLDVNVV
ALLMNRTDPKSLITHVCDLMSGARIHGLVFGDDTDQEAVAQMLDFISSQTFIPILGIHGGASMIMADKDP
TSTFFQFGASIQQQATVMLKIMQDYDWHVFSLVTTIFPGYRDFISFIKTTVDNSFVGWDMQNVITLDTSF
EDAKTQVQLKKIHSSVILLYCSKDEAVLILSEARSLGLTGYDFFWIVPSLVSGNTELIPKEFPSGLISVS
YDDWDYSLEARVRDGLGILTTAASSMLEKFSYIPEAKASCYGQAEKPETPLHTLHQFMVNVTWDGKDLSF
TEEGYQVHPRLVVIVLNKDREWEKVGKWENQTLSLRHAVWPRYKSFSDCEPDDNHLSIVTLEEAPFVIVE
DIDPLTETCVRNTVPCRKFVKINNSTNEGMNVKKCCKGFCIDILKKLSRTVKFTYDLYLVTNGKHGKKVN
NVWNGMIGEVVYQRAVMAVGSLTINEERSEVVDFSVPFVETGISVMVSRSNGTVSPSAFLEPFSASVWVM
MFVMLLIVSAIAVFVFEYFSPVGYNRNLAKGKAPHGPSFTIGKAIWLLWGLVFNNSVPVQNPKGTTSKIM
VSVWAFFAVIFLASYTANLAAFMIQEEFVDQVTGLSDKKFQRPHDYSPPFRFGTVPNGSTERNIRNNYPY
MHQYMTRFNQRGVEDALVSLKTGKLDAFIYDAAVLNYKAGRDEGCKLVTIGSGYIFATTGYGIALQKGSP
WKRQIDLALLQFVGDGEMEELETLWLTGICHNEKNEVMSSQLDIDNMAGVFYMLAAAMALSLITFIWEHL
FYWKLRFCFTGVCSDRPGLLFSISRGIYSCIHGVHIEEKKKSPDFNLTGSQSNMLKLLRSAKNISNMSNM
NSSRMDSPKRATDFIQRGSLIVDMVSDKGNLIYSDNRSFQGKDSIFGDNMNELQTFVANRHKDNLSNYVF
QGQHPLTLNESNPNTVEVAVSTESKGNSRPRQLWKKSMESLRQDSLNQNPVSQRDEKTAENRTHSLKSPR
YLPEEVAHSDISETSSRATCHREPDNNKNHKTKDNFKRSMASKYPKDCSDVDRTYMKTKASSPRDKIYTI
DGEKEPSFHLDPPQFVENITLPENVGFPDTYQDHNENFRKGDSTLPMNRNPLHNEDGLPNNDQYKLYAKH
FTLKDKGSPHSEGSDRYRQNSTHCRSCLSNLPTYSGHFTMRSPFKCDACLRMGNLYDIDEDQMLQETGNP
ATREEVYQQDWSQNNALQFQKNKLRINRQHSYDNILDKPREIDLSRPSRSISLKDRERLLEGNLYGSLFS
VPSSKLLGNKSSLFPQGLEDSKRSKSLLPDHASDNPFLHTYGDDQRLVIGRCPSDPYKHSLPSQAVNDSY
LRSSLRSTASYCSRDSRGHSDVYISEHVMPYAANKNTMYSTPRVLNSCSNRRVYKKMPSIESDV

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_012573
ORF Size 4392 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_012573.1, NM_012573.2, NM_012573.3, NP_036705
RefSeq Size 4717
Locus ID 24409
Cytogenetics 10q11
MW 165.5 kDa
Gene Summary may play a role in synaptic transmission, learning and memory [RGD, Feb 2006]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications.
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.