Jak1 (NM_053466) Rat Tagged ORF Clone

CAT#: RR209166

  • TrueORF®

Jak1 (Myc-DDK-tagged ORF) - Rat Janus kinase 1 (Jak1), (10 ug)

  View "NM_053466" in other vectors (5)

USD 1,890.00


Availability*
5 Weeks

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name Jak1 (NM_053466) Rat Tagged ORF Clone
Symbol Jak1
Vector pCMV6-Entry
Sequence Data
>RR209166 representing NM_053466
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAGTATCTAAATATAAAAGAGGACTGCAATGCCATGGCTTTCTGTGCTAAAATGAGGAGCTTCAAGA
AGACGGAGGTGAAGCAGGTGGCCCCTGAGCCAGGAGTGGAAGTGACTTTCTATCTGTTGGACAGGGAGCC
CCTCCGCCTGGGCAGCGGAGAGTACACCGCGGAGGAGCTGTGCATCAGGGCCGCACAGGAATGCAGTATC
TCTCCTCTCTGCCACAACCTCTTCGCCTTGTATGATGAGAGCACCAAGCTCTGGTATGCTCCAAACCACA
TCATCACTGTGGATGACAAAATGTCTCTCCGGCTGCACTACCGCATGAGGTTCTACTTTACCAACTGGCA
TGGAACCAATGACAATGAACAGTCTGTATGGCGACATTCTCCAAAGAAGCAGAAAAATGGCTATGAGAAG
AAAAAGGTTCCAGAAGCAACCCCACTCCTTGATGCCAGTTCACTGGAGTATCTGTTTGCGCAGGGACAGT
ATGATTTGATCAAATGCCTGGCTCCCATTCGGGACCCCAAGACAGAGCAAGATGGACATGATATTGAGAA
TGAGTGCCTGGGCATGGCTGTCCTGGCCATCTCACACTATGCCATGATGAAGAAGATGCAGTTGCCAGAG
CTTCCCAAAGACATCAGCTACAAGCGATATATTCCAGAAACATTGAATAAATCCATCAGACAGAGGAATC
TTCTTACCAGGATGCGAATAAATAATGTTTTCAAGGATTTCTTGAAGGAATTTAACAACAAGACCATCTG
TGACAGCAGTGTGTCTACACACGACCTGAAGGTGAAGTACCTGGCTACCTTGGAAACCTTAACCAAGCAT
TATGGAGCCGAGATATTTGAGACTTCTATGCTCCTGATTTCATCAGAAAATGAGCTGAGTCGGTGCCATT
CCAACGACAGTGGCAATGTTCTCTATGAAGTCATGGTAACAGGAAATCTCGGGATCCAGTGGCGGCAGAA
ACCAAATGTTCTTCCTGTTGAAAAGGAAAAAAATAAACTGAAGCGGAAAAAACTGGACTATAATAAACAC
AAGAAGGAGGATGACAGAAACAAACTCCGGGAAGAGTGGAACAGTTTTTCCTATTTCCCCGAGATTACCC
ACATTGTTATCAAGGAGTCTGTGGTCAGCATTAACAAACAGGACAACAAGAACATGGAACTAAAGCTCTC
TTCTCATGAGGAAGCCTTGTCCTTCGTGTCCCTGGTAGATGGCTACTTCCGGCTCACTGCAGATGCTCAC
CATTACCTCTGTACTGATGTGGCTCCCCCGCTGATTGTCCACAACATACAGAATGGCTGTCACGGTCCAA
TCTGCACAGAATATGCCATCAATAAGCTGCGGCAGGAGGGGAGTGAGGAGGGGATGTACGTGCTGAGGTG
GAGCTGCACCGACTTTGACAACATTCTTATGACTGTCAGCTGCTTCGAAAAGTCCGAGGTATTGGGTAAT
CAGAAGCAGTTCAAGAACTTTCAGATTGAGGTGCAGAAGGGCCGCTACAGCCTGCATGGCTCTGTTGACC
ACTTTCCCAGCCTGAGAGACCTCATGAACCACCTCAAGAAGCAGATCCTGCGCACGGACAATATAAGCTT
TGTGCTGAAACGCTGCTGTCAGCCTAAGCCTCGAGAAATCTCCAACCTACTTGTAGCCACTAAGAAAGCC
CAGGAGTGGCAGCCTGTCTACTCTATGAGCCAGCTGAGTTTCGATCGGATCCTTAAGAAAGATATTATCC
AAGGTGAGCACCTTGGCAGAGGCACAAGAACACATATCTATTCTGGGACCCTGCTGGATTACAAGGACGA
TGAAGGAATTGCTGAAGAAAAGAAGATAAAAGTGATTCTCAAAGTCCTAGACCCTAGCCACCGGGACATT
TCACTGGCCTTCTTTGAGGCAGCCAGCATGATGAGACAGGTTTCCCACAAACACATCGTGTACCTCTACG
GCGTCTGTGTCCGAGATGTGGAAAATATCATGGTGGAAGAGTTTGTGGAGGGGGGGCCATTGGATCTCTT
CATGCACCGGAAAAGTGATGCACTTACTACCCCTTGGAAGTTTAAAGTTGCCAAACAGCTGGCCAGCGCC
CTGAGTTACTTGGAAGATAAAGACCTCGTTCATGGAAATGTGTGCACTAAAAACCTCCTCCTGGCCCGTG
AGGGCATTGACAGTGACATTGGCCCGTTCATCAAGCTTAGTGACCCTGGCATCCCAGTCTCTGTGCTGAC
CAGGCAAGAGTGCATAGAGCGAATTCCCTGGATCGCTCCTGAGTGTGTTGAAGACTCCAAGAACCTGAGT
GTGGCTGCTGACAAGTGGAGCTTTGGAACCACACTCTGGGAAATCTGCTACAATGGCGAGATCCCACTCA
AGGACAAGACCCTCATTGAGAAAGAGAGGTTTTATGAAAGCCGCTGCAGGCCAGTGACACCATCTTGCAA
GGAGCTAGCTGACCTCATGACTCGCTGCATGAACTATGATCCCAACCAGAGACCTTTCTTCCGAGCCATC
ATGAGGGACATTAACAAGCTGGAGGAGCAGAATCCAGACATTGTTTCAGAAAAGCAGCCAATAACAGAGG
TGGATCCCACTCATTTTGAAAAGCGTTTCCTAAAGAGGATTCGTGACTTGGGAGAGGGTCACTTTGGGAA
GGTTGAGCTCTGCAGATATGATCCTGAGGGAGACAACACAGGGGAACAGGTAGCTGTCAAGTCCCTGAAG
CCTGAGAGTGGAGGTAACCACATAGCTGATCTGAAGAAGGAGATAGAGATCTTACGGAACCTCTACCACG
AGAACATTGTGAAGTATAAAGGAATCTGCATGGAAGACGGAGGGAATGGTATCAAGCTCATCATGGAGTT
TCTGCCTTCGGGAAGCCTAAAGGAATATCTGCCAAAGAATAAGAACAAAATCAACCTCAAACAGCAGCTA
AAATATGCCATCCAGATTTGTAAGGGGATGGACTATCTGGGCTCTCGGCAATATGTTCACCGGGACTTAG
CAGCAAGAAATGTCCTTGTTGAGAGTGAACACCAAGTGAAGATCGGAGACTTTGGTTTAACCAAAGCAAT
TGAGACCGATAAGGAGTACTACACAGTCAAGGATGACCGGGACAGCCCAGTGTTTTGGTACGCTCCGGAG
TGTTTAATCCAGTGTAAATTTTATATCGCCTCTGATGTCTGGTCTTTTGGAGTGACACTGCACGAGTTGC
TCACGTACTGTGACTCAGATTTTAGTCCCATGGCCTTGTTCCTGAAAATGATAGGCCCAACTCATGGCCA
GATGACAGTAACACGGCTTGTGAATACTCTGAAAGAAGGAAAGCGCCTGTCCTGTCCACCCAACTGTCCC
GATGAGGTTTATCAGCTTATGAGAAAATGCTGGGAATTCCAACCATCTAATCGGACAACCTTTCAGAACC
TTATTGAAGGATTTGAAGCACTTTTAAAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RR209166 representing NM_053466
Red=Cloning site Green=Tags(s)

MQYLNIKEDCNAMAFCAKMRSFKKTEVKQVAPEPGVEVTFYLLDREPLRLGSGEYTAEELCIRAAQECSI
SPLCHNLFALYDESTKLWYAPNHIITVDDKMSLRLHYRMRFYFTNWHGTNDNEQSVWRHSPKKQKNGYEK
KKVPEATPLLDASSLEYLFAQGQYDLIKCLAPIRDPKTEQDGHDIENECLGMAVLAISHYAMMKKMQLPE
LPKDISYKRYIPETLNKSIRQRNLLTRMRINNVFKDFLKEFNNKTICDSSVSTHDLKVKYLATLETLTKH
YGAEIFETSMLLISSENELSRCHSNDSGNVLYEVMVTGNLGIQWRQKPNVLPVEKEKNKLKRKKLDYNKH
KKEDDRNKLREEWNSFSYFPEITHIVIKESVVSINKQDNKNMELKLSSHEEALSFVSLVDGYFRLTADAH
HYLCTDVAPPLIVHNIQNGCHGPICTEYAINKLRQEGSEEGMYVLRWSCTDFDNILMTVSCFEKSEVLGN
QKQFKNFQIEVQKGRYSLHGSVDHFPSLRDLMNHLKKQILRTDNISFVLKRCCQPKPREISNLLVATKKA
QEWQPVYSMSQLSFDRILKKDIIQGEHLGRGTRTHIYSGTLLDYKDDEGIAEEKKIKVILKVLDPSHRDI
SLAFFEAASMMRQVSHKHIVYLYGVCVRDVENIMVEEFVEGGPLDLFMHRKSDALTTPWKFKVAKQLASA
LSYLEDKDLVHGNVCTKNLLLAREGIDSDIGPFIKLSDPGIPVSVLTRQECIERIPWIAPECVEDSKNLS
VAADKWSFGTTLWEICYNGEIPLKDKTLIEKERFYESRCRPVTPSCKELADLMTRCMNYDPNQRPFFRAI
MRDINKLEEQNPDIVSEKQPITEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLK
PESGGNHIADLKKEIEILRNLYHENIVKYKGICMEDGGNGIKLIMEFLPSGSLKEYLPKNKNKINLKQQL
KYAIQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFGLTKAIETDKEYYTVKDDRDSPVFWYAPE
CLIQCKFYIASDVWSFGVTLHELLTYCDSDFSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLSCPPNCP
DEVYQLMRKCWEFQPSNRTTFQNLIEGFEALLK

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_053466
ORF Size 3459 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_053466.1, NP_445918
RefSeq Size 4291
RefSeq ORF 3462
Locus ID 84598
Cytogenetics 5q33
MW 133.3 kDa
Gene Summary protein-tyrosine kinases; involved in intracellular signal transduction [RGD, Feb 2006]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications.

Other Versions

Other products for "Jak1"
Frequently bought together (2)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 299.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 550.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
10 percent off protein banner ad
68 Mouse Clones
20%off selected tag antibodies