Insulin Receptor R (INSRR) (NM_014215) Human Tagged ORF Clone

CAT#: RC600011

INSRR (DDK-His-tagged)-Extra Cellular Domain Clone of Homo sapiens insulin receptor-related receptor, Signal peptide (1-26) plus EC domain (747-921)

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: DDK-His
• Symbol: Insulin Receptor R
• Synonyms: IRR
• Vector: pCMV6-XL5-DDK-His
• E. coli Selection: Ampicillin (100 ug/mL)
• Mammalian Cell Selection: None
• Sequence Data:
  ORF Nucleotide Sequence

  >RC600011 representing leader sequence plus the extracellular domain region of NM_014215
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  GTAATACGACTCACTATAGGGCGGCCGCGAATTCGTCGACTGGATCTGGTACCGAGGAGATCCGCCGCCG
  CGATCGCC
  
  ATGGCAGTGCCTAGTCTGTGGCCCTGGGGAGCATGCCTGCCTGTGATCTTCCTCTCCTTGGGATTTGGCC
  TGGATACAGCAGCTGGGCCCCTCCGGCTGGGGGGCAACAGCTCGGATTTCGAGATCCAGGAGGACAAGGT
  GCCCCGTGAGCGAGCGGTGCTGAGCGGCCTGCGCCACTTCACGGAATACCGGATCGACATCCATGCCTGC
  AACCACGCGGCGCACACCGTGGGCTGCAGCGCCGCCACCTTCGTCTTTGCGCGCACCATGCCCCACAGAG
  AGGCTGATGGTATTCCAGGAAAGGTGGCCTGGGAGGCCTCCAGCAAGAACAGTGTCCTTCTGCGCTGGCT
  CGAGCCACCAGACCCCAACGGACTCATCCTCAAGTACGAAATCAAGTACCGCCGCTTGGGAGAGGAGGCC
  ACAGTGCTGTGTGTGTCCCGTCTTCGATATGCGAAGTTTGGGGGAGTCCACCTGGCCCTGCTGCCCCCTG
  GAAACTACTCTGCCAGGGTTAGGGCAACCTCACTGGCTGGCAATGGCTCTTGGACAGACAGTGTTGCCTT
  CTACATCCTTGGCCCAGAGGAGGAGGATGCTGGGGGGCTGCAT
  
  ACGCGTTCAGGCGACTACAAGGATGACGACGATAAGGGATCTCATCATCACCATCACCATTAATGAGATC
  TGGTACCGATATCAAGCTTGTCGACTCTAGA
  Protein Sequence

  >RC600011 representing signal peptide plus the extracellular domain region of NM_014215
  Red=Cloning sites Green= DDK and 6XHIS Tags
  
  MAVPSLWPWGACLPVIFLSLGFGLDTAAGPLRLGGNSSDFEIQEDKVPRERAVLSGLRHFTEYRIDIHAC
  NHAAHTVGCSAATFVFARTMPHREADGIPGKVAWEASSKNSVLLRWLEPPDPNGLILKYEIKYRRLGEEA
  TVLCVSRLRYAKFGGVHLALLPPGNYSARVRATSLAGNGSWTDSVAFYILGPEEEDAGGLH
  
  TRSGTRSGDYKDDDDKGSHHHHHH
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene
• ACCN: NM_014215
• ORF Size: 603 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the extra cellular domain of the protein with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_014215.2, NP_055030.1
• RefSeq Size: 4193 bp
• RefSeq ORF: 3894 bp
• Locus ID: 3645
• UniProt ID: P14616
• Cytogenetics: 1q23.1
• Protein Families: Druggable Genome, Protein Kinase, Transmembrane
• Protein Pathways: Prostate cancer, Regulation of actin cytoskeleton
• MW: 21.9 kDa
• Gene Summary: Receptor with tyrosine-protein kinase activity. Functions as a pH sensing receptor which is activated by increased extracellular pH. Activates an intracellular signaling pathway that involves IRS1 and AKT1/PKB.[UniProtKB/Swiss-Prot Function]