CACNA2D2 (NM_001174051) Human Tagged ORF Clone

CAT#: RC230662

CACNA2D2 (Myc-DDK-tagged)-Human calcium channel, voltage-dependent, alpha 2/delta subunit 2 (CACNA2D2), transcript variant 3

Need custom modification / cloning service?
Get a free quote

USD 1,762.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name CACNA2D2 (NM_001174051) Human Tagged ORF Clone
Symbol CACNA2D2
Synonyms CACNA2D
Vector pCMV6-Entry
Sequence Data
>RC230662 representing NM_001174051
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGTGCCGGCTCGGACCTGCGGCGCCTCTCGGCCCGGCCCAGCGCGGACTGCGCGCCCCTGGCCCG
GCTGCGGCCCCCACCCTGGCCCCGGCACCCGGCGCCCGACGTCCGGGCCCCCGCGCCCGCTGTGGCTGCT
GCTGCCGCTTCTACCGCTGCTCGCCGCCCCCGGCGCCTCTGCCTACAGCTTCCCCCAGCAGCACACGATG
CAGCACTGGGCCCGGCGTCTGGAGCAGGAGGTCGACGGCGTGATGCGGATTTTTGGAGGCGTCCAGCAGC
TCCGTGAGATTTACAAGGACAACCGGAACCTGTTCGAGGTACAGGAGAATGAGCCTCAGAAGTTGGTGGA
GAAGGTGGCAGGGGACATTGAGAGCCTTCTGGACAGGAAGGTGCAGGCCCTGAAGAGACTGGCTGATGCT
GCAGAGAACTTCCAGAAAGCACACCGCTGGCAGGACAACATCAAGGAGGAAGACATCGTGTACTATGACG
CCAAGGCTGACGCTGAGCTGGACGACCCTGAGAGTGAGGATGTGGAAAGGGGGTCTAAGGCCAGCACCCT
AAGGCTGGACTTCATCGAGGACCCAAACTTCAAGAACAAGGTCAACTATTCATACGCGGCTGTACAGATC
CCTACGGACATCTACAAAGGCTCCACTGTCATCCTCAATGAGCTCAACTGGACAGAGGCCCTGGAGAATG
TGTTCATGGAAAACCGCAGACAAGACCCCACACTGCTGTGGCAGGTCTTCGGCAGCGCCACAGGAGTCAC
TCGCTACTACCCGGCCACCCCGTGGCGAGCCCCCAAGAAGATCGACCTGTACGATGTCCGAAGGAGACCC
TGGTATATCCAGGGGGCCTCGTCACCCAAAGACATGGTCATCATCGTGGATGTGAGTGGCAGTGTGAGCG
GCCTGACCCTGAAGCTGATGAAGACATCTGTCTGCGAGATGCTGGACACGCTGTCTGATGATGACTATGT
GAATGTGGCCTCGTTCAACGAGAAGGCACAGCCTGTGTCATGCTTCACACACCTGGTGCAGGCCAATGTG
CGCAACAAGAAGGTGTTCAAGGAAGCTGTGCAGGGCATGGTGGCCAAGGGCACCACAGGCTACAAGGCCG
GCTTTGAGTATGCCTTTGACCAGCTGCAGAACTCCAACATCACTCGGGCCAACTGCAACAAGATGATCAT
GATGTTCACGGATGGTGGTGAGGACCGCGTGCAGGACGTCTTTGAGAAGTACAATTGGCCAAACCGGACG
GTGCGCGTGTTTACTTTCTCCGTGGGGCAGCATAACTATGACGTCACACCGCTGCAGTGGATGGCCTGTG
CCAACAAAGGCTACTATTTTGAGATCCCTTCCATCGGAGCCATCCGCATCAACACACAGGAATATCTAGA
TGTGTTGGGCAGGCCCATGGTGCTGGCAGGCAAGGAGGCCAAGCAGGTGCAGTGGACCAACGTGTATGAG
GATGCACTGGGACTGGGGTTGGTGGTAACAGGGACCCTCCCTGTTTTCAACCTGACACAGGATGGCCCTG
GGGAAAAGAAGAACCAGCTGATCCTGGGCGTGATGGGCATTGACGTGGCTCTGAATGACATCAAGAGGCT
GACCCCCAACTACACGCTTGGAGCCAACGGCTATGTGTTTGCCATTGACCTGAACGGCTACGTGTTGCTG
CACCCCAATCTCAAGCCCCAGACCACCAACTTCCGGGAGCCTGTGACTCTGGACTTCCTGGATGCGGAGC
TAGAGGATGAGAACAAGGAAGAGATCCGTCGGAGCATGATTGATGGCAACAAGGGCCACAAGCAGATCAG
AACGTTGGTCAAGTCCCTGGATGAGAGGTACATAGATGAGGTGACACGGAACTACACCTGGGTGCCTATA
AGGAGCACTAACTACAGCCTGGGGCTGGTGCTCCCACCCTACAGCACCTTCTACCTCCAAGCCAATCTCA
GTGACCAGATCCTGCAGGTCAAGTTGCCAATCAGCAAACTGAAGGATTTTGAGTTCCTGCTCCCCAGCAG
CTTTGAGTCTGAAGGACACGTTTTCATTGCTCCCAGAGAGTACTGCAAGGACCTGAATGCCTCAGACAAC
AACACCGAGTTCCTGAAAAACTTTATTGAGCTCATGGAGAAAGTGACTCCAGACTCCAAGCAGTGCAACA
ACTTCCTTCTGCACAACCTGATCTTGGACACGGGCATCACGCAGCAGCTGGTAGAGCGTGTGTGGAGGGA
CCAGGATCTCAACACGTACAGCCTACTGGCCGTGTTCGCTGCCACAGACGGTGGCATCACCCGAGTCTTC
CCCAACAAGGCAGCTGAGGACTGGACAGAGAACCCTGAGCCCTTCAATGCCAGCTTCTACCGCCGCAGCC
TGGATAACCACGGTTATGTCTTCAAGCCCCCACACCAGGATGCCCTGTTAAGGCCGCTGGAGCTGGAGAA
TGACACTGTGGGCATCCTCGTCAGCACAGCTGTGGAGCTCAGCCTAGGCAGGCGCACACTGAGGCCAGCA
GTGGTGGGCGTCAAGCTGGACCTAGAGGCTTGGGCTGAGAAGTTCAAGGTGCTAGCCAGCAACCGTACCC
ACCAAGACCAGCCTCAGAAGTGCGGCCCCAACAGCCACTGTGAGATGGACTGCGAGGTTAACAATGAGGA
CTTACTCTGTGTCCTCATTGATGATGGAGGATTCCTGGTGCTGTCAAACCAGAACCATCAGTGGGACCAG
GTGGGCAGGTTCTTCAGTGAGGTGGATGCCAACCTGATGCTGGCACTCTACAATAACTCCTTCTACACCC
GCAAGGAGTCCTATGACTATCAGGCAGCCTGTGCCCCTCAGCCCCCTGGCAACCTGGGTGCTGCACCCCG
GGGTGTCTTTGTGCCCACCGTTGCAGATTTCCTTAACCTGGCCTGGTGGACCTCTGCTGCCGCCTGGTCC
CTGTTCCAGCAGCTTCTCTACGGCCTCATCTACCACAGCTGGTTCCAAGCAGACCCCGCGGAGGCCGAGG
GGAGCCCCGAGACGCGCGAGAGCAGCTGCGTCATGAAACAGACCCAGTACTACTTCGGCTCGGTAAACGC
CTCCTACAACGCCATCATCGACTGCGGAAACTGCTCCAGGCTGTTCCACGCGCAGAGACTGACCAACACC
AATCTTCTCTTTGTGGTGGCCGAGAAGCCGCTGTGCAGCCAGTGCGAGGCTGGCCGGCTGCTGCAGAAGG
AGACGCACTCGGACGGCCCGGAGCAGTGTGAGCTAGTGCAGAGACCGCGATACCGGAGAGGCCCGCACAT
CTGCTTCGACTACAACGCGACAGAAGATACCTCAGACTGTGGCCGCGGGGCCTCCTTCCCGCCGTCGCTG
GGCGTCCTGGTCTCCCTGCAACTGCTGCTCCTCCTGGGCCTGCCGCCCCGGCCGCAGCCTCAAGTCCTCG
TCCACGCCTCTCGCCGCCTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC230662 representing NM_001174051
Red=Cloning site Green=Tags(s)

MAVPARTCGASRPGPARTARPWPGCGPHPGPGTRRPTSGPPRPLWLLLPLLPLLAAPGASAYSFPQQHTM
QHWARRLEQEVDGVMRIFGGVQQLREIYKDNRNLFEVQENEPQKLVEKVAGDIESLLDRKVQALKRLADA
AENFQKAHRWQDNIKEEDIVYYDAKADAELDDPESEDVERGSKASTLRLDFIEDPNFKNKVNYSYAAVQI
PTDIYKGSTVILNELNWTEALENVFMENRRQDPTLLWQVFGSATGVTRYYPATPWRAPKKIDLYDVRRRP
WYIQGASSPKDMVIIVDVSGSVSGLTLKLMKTSVCEMLDTLSDDDYVNVASFNEKAQPVSCFTHLVQANV
RNKKVFKEAVQGMVAKGTTGYKAGFEYAFDQLQNSNITRANCNKMIMMFTDGGEDRVQDVFEKYNWPNRT
VRVFTFSVGQHNYDVTPLQWMACANKGYYFEIPSIGAIRINTQEYLDVLGRPMVLAGKEAKQVQWTNVYE
DALGLGLVVTGTLPVFNLTQDGPGEKKNQLILGVMGIDVALNDIKRLTPNYTLGANGYVFAIDLNGYVLL
HPNLKPQTTNFREPVTLDFLDAELEDENKEEIRRSMIDGNKGHKQIRTLVKSLDERYIDEVTRNYTWVPI
RSTNYSLGLVLPPYSTFYLQANLSDQILQVKLPISKLKDFEFLLPSSFESEGHVFIAPREYCKDLNASDN
NTEFLKNFIELMEKVTPDSKQCNNFLLHNLILDTGITQQLVERVWRDQDLNTYSLLAVFAATDGGITRVF
PNKAAEDWTENPEPFNASFYRRSLDNHGYVFKPPHQDALLRPLELENDTVGILVSTAVELSLGRRTLRPA
VVGVKLDLEAWAEKFKVLASNRTHQDQPQKCGPNSHCEMDCEVNNEDLLCVLIDDGGFLVLSNQNHQWDQ
VGRFFSEVDANLMLALYNNSFYTRKESYDYQAACAPQPPGNLGAAPRGVFVPTVADFLNLAWWTSAAAWS
LFQQLLYGLIYHSWFQADPAEAEGSPETRESSCVMKQTQYYFGSVNASYNAIIDCGNCSRLFHAQRLTNT
NLLFVVAEKPLCSQCEAGRLLQKETHSDGPEQCELVQRPRYRRGPHICFDYNATEDTSDCGRGASFPPSL
GVLVSLQLLLLLGLPPRPQPQVLVHASRRL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001174051
ORF Size 3450 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001174051.1, NM_001174051.2, NP_001167522
RefSeq ORF 3453
Locus ID 9254
Cytogenetics 3p21.31
Protein Families Ion Channels: Other, Druggable Genome
Protein Pathways MAPK signaling pathway, Cardiac muscle contraction, Hypertrophic cardiomyopathy (HCM), Arrhythmogenic right ventricular cardiomyopathy (ARVC), Dilated cardiomyopathy
MW 130.3 kDa
Gene Summary Calcium channels mediate the entry of calcium ions into the cell upon membrane polarization. This gene encodes the alpha-2/delta subunit of the voltage-dependent calcium channel complex. The complex consists of the main channel-forming subunit alpha-1, and auxiliary subunits alpha-2/delta, beta, and gamma. The auxiliary subunits function in the assembly and membrane localization of the complex, and modulate calcium currents and channel activation/inactivation kinetics. The subunit encoded by this gene undergoes post-translational cleavage to yield the extracellular alpha2 peptide and a membrane-anchored delta polypeptide. This subunit is a receptor for the antiepileptic drug, gabapentin. Mutations in this gene are associated with early infantile epileptic encephalopathy. Single nucleotide polymorphisms in this gene are correlated with increased sensitivity to opioid drugs. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Mar 2014]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)