SLC5A7 (NM_021815) Human Tagged ORF Clone

CAT#: RC224138

SLC5A7 (Myc-DDK-tagged)-Human solute carrier family 5 (choline transporter), member 7 (SLC5A7)

Need custom modification / cloning service?
Get a free quote

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Cited in 2 publications.

Product images

Specifications

Product Data
Product Name SLC5A7 (NM_021815) Human Tagged ORF Clone
Symbol SLC5A7
Synonyms CHT; CHT1; hCHT; HMN7A
Vector pCMV6-Entry
Sequence Data
>RC224138 representing NM_021815
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTTTCCATGTGGAAGGACTGATAGCTATCATCGTGTTCTACCTTCTAATTTTGCTGGTTGGAATAT
GGGCTGCCTGGAGAACCAAAAACAGTGGCAGCGCAGAAGAGCGCAGCGAAGCCATCATAGTTGGTGGCCG
AGATATTGGTTTATTGGTTGGTGGATTTACCATGACAGCTACCTGGGTCGGAGGAGGGTATATCAATGGC
ACAGCTGAAGCAGTTTATGTACCAGGTTATGGCCTAGCTTGGGCTCAGGCACCAATTGGATATTCTCTTA
GTCTGATTTTAGGTGGCCTGTTCTTTGCAAAACCTATGCGTTCAAAGGGGTATGTGACCATGTTAGACCC
GTTTCAGCAAATCTATGGAAAACGCATGGGCGGACTCCTGTTTATTCCTGCACTGATGGGAGAAATGTTC
TGGGCTGCAGCAATTTTCTCTGCTTTGGGAGCCACCATCAGCGTGATCATCGATGTGGATATGCACATTT
CTGTCATCATCTCTGCACTCATTGCCACTCTGTACACACTGGTGGGAGGGCTCTATTCTGTGGCCTACAC
TGATGTCGTTCAGCTCTTTTGCATTTTTGTAGGGCTGTGGATCAGCGTCCCCTTTGCATTGTCACATCCT
GCAGTCGCAGACATCGGGTTCACTGCTGTGCATGCCAAATACCAAAAGCCGTGGCTGGGAACTGTTGACT
CATCTGAAGTCTACTCTTGGCTTGATAGTTTTCTGTTGTTGATGCTGGGTGGAATCCCATGGCAAGCATA
CTTTCAGAGGGTTCTCTCTTCTTCCTCAGCCACCTATGCTCAAGTGCTGTCCTTCCTGGCAGCTTTCGGG
TGCCTGGTGATGGCCATCCCAGCCATACTCATTGGGGCCATTGGAGCATCAACAGACTGGAACCAGACTG
CATATGGGCTTCCAGATCCCAAGACTACAGAAGAGGCAGACATGATTTTACCAATTGTTCTGCAGTATCT
CTGCCCTGTGTATATTTCTTTCTTTGGTCTTGGTGCAGTTTCTGCTGCTGTTATGTCATCAGCAGATTCT
TCCATCTTGTCAGCAAGTTCCATGTTTGCACGGAACATCTACCAGCTTTCCTTCAGACAAAATGCTTCGG
ACAAAGAAATCGTTTGGGTTATGCGAATCACAGTGTTTGTGTTTGGAGCATCTGCAACAGCCATGGCCTT
GCTGACGAAAACTGTGTATGGGCTCTGGTACCTCAGTTCTGACCTTGTTTACATCGTTATCTTCCCCCAG
CTGCTTTGTGTACTCTTTGTTAAGGGAACCAACACCTATGGGGCCGTGGCAGGTTATGTTTCTGGCCTCT
TCCTGAGAATAACTGGAGGGGAGCCATATCTGTATCTTCAGCCCTTGATCTTCTACCCTGGCTATTACCC
TGATGATAATGGTATATATAATCAGAAATTTCCATTTAAAACACTTGCCATGGTTACATCATTCTTAACC
AACATTTGCATCTCCTATCTAGCCAAGTATCTATTTGAAAGTGGAACCTTGCCACCTAAATTAGATGTAT
TTGATGCTGTTGTTGCAAGACACAGTGAAGAAAACATGGATAAGACAATTCTTGTCAAAAATGAAAATAT
TAAATTAGATGAACTTGCACTTGTGAAGCCACGACAGAGCATGACCCTCAGCTCAACTTTCACCAATAAA
GAGGCCTTCCTTGATGTTGATTCCAGTCCAGAAGGGTCTGGGACTGAAGATAATTTACAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC224138 representing NM_021815
Red=Cloning site Green=Tags(s)

MAFHVEGLIAIIVFYLLILLVGIWAAWRTKNSGSAEERSEAIIVGGRDIGLLVGGFTMTATWVGGGYING
TAEAVYVPGYGLAWAQAPIGYSLSLILGGLFFAKPMRSKGYVTMLDPFQQIYGKRMGGLLFIPALMGEMF
WAAAIFSALGATISVIIDVDMHISVIISALIATLYTLVGGLYSVAYTDVVQLFCIFVGLWISVPFALSHP
AVADIGFTAVHAKYQKPWLGTVDSSEVYSWLDSFLLLMLGGIPWQAYFQRVLSSSSATYAQVLSFLAAFG
CLVMAIPAILIGAIGASTDWNQTAYGLPDPKTTEEADMILPIVLQYLCPVYISFFGLGAVSAAVMSSADS
SILSASSMFARNIYQLSFRQNASDKEIVWVMRITVFVFGASATAMALLTKTVYGLWYLSSDLVYIVIFPQ
LLCVLFVKGTNTYGAVAGYVSGLFLRITGGEPYLYLQPLIFYPGYYPDDNGIYNQKFPFKTLAMVTSFLT
NICISYLAKYLFESGTLPPKLDVFDAVVARHSEENMDKTILVKNENIKLDELALVKPRQSMTLSSTFTNK
EAFLDVDSSPEGSGTEDNLQ

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_021815
ORF Size 1740 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_021815.1, NM_021815.2, NM_021815.3, NM_021815.4, NP_068587
RefSeq Size 5158
RefSeq ORF 1743
Locus ID 60482
Cytogenetics 2q12.3
Domains SSF
Protein Families Transmembrane
MW 63 kDa
Gene Summary This gene encodes a sodium ion- and chloride ion-dependent high-affinity transporter that mediates choline uptake for acetylcholine synthesis in cholinergic neurons. The protein transports choline from the extracellular space into presynaptic terminals for synthesis into acetylcholine. Increased choline uptake results from increased density of this protein in synaptosomal plasma membranes in response to depolarization of cholinergic terminals. Dysfunction of cholinergic signaling has been implicated in various disorders including depression, attention-deficit disorder, and schizophrenia. An allelic variant of this gene is associated with autosomal dominant distal hereditary motor neuronopathy type VIIA. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2015]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (2)