GAK (NM_005255) Human Tagged ORF Clone

CAT#: RC223572

Reviews ()
Write a review

GAK (Myc-DDK-tagged)-Human cyclin G associated kinase (GAK)



Reconstitution Protocol

USD 1,141.00

In Stock*

Size
    • 10 ug

Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol GAK
Synonyms DNAJ26; DNAJC26
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC223572 representing NM_005255
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGCTGCTGCAGTCGGCGCTCGACTTCTTGGCGGGTCCAGGCTCCCTGGGCGGTGCTTCCGGCCGCG
ACCAGAGTGACTTCGTGGGGCAGACGGTGGAACTGGGCGAGCTGCGGCTGCGGGTGCGGCGGGTCCTGGC
CGAAGGAGGGTTTGCATTTGTGTATGAAGCTCAAGATGTGGGGAGTGGCAGAGAGTATGCATTAAAGAGG
CTATTATCCAATGAAGAGGAAAAGAACAGAGCCATCATTCAAGAAGTTTGCTTCATGAAAAAGCTTTCCG
GCCACCCGAACATTGTCCAGTTTTGTTCTGCAGCGTCTATAGGAAAAGAGGAGTCAGACACGGGGCAGGC
TGAGTTCCTCTTGCTCACAGAGCTCTGTAAAGGGCAGCTGGTGGAATTTTTGAAGAAAATGGAATCTCGA
GGCCCCCTTTCGTGCGACACGGTTCTGAAGATCTTCTACCAGACGTGCCGCGCCGTGCAGCACATGCACC
GGCAGAAGCCGCCCATCATCCACAGGGACCTCAAGGTTGAGAACTTGTTGCTTAGTAACCAAGGGACCAT
TAAGCTGTGTGACTTTGGCAGTGCCACGACCATCTCGCACTACCCTGACTACAGCTGGAGCGCCCAGAGG
CGAGCCCTGGTGGAGGAAGAGATCACGAGGAATACAACACCAATGTATAGAACACCAGAAATCATAGACT
TGTATTCCAACTTCCCGATCGGCGAGAAGCAGGATATCTGGGCCCTGGGCTGCATCTTGTACCTGCTGTG
CTTCCGGCAGCACCCTTTTGAGGATGGAGCGAAACTTCGAATAGTCAATGGGAAGTACTCGATCCCCCCG
CACGACACGCAGTACACGGTCTTCCACAGCCTCATCCGCGCCATGCTGCAGGTGAACCCGGAGGAGCGGC
TGTCCATCGCCGAGGTGGTGCACCAGCTGCAGGAGATCGCGGCCGCCCGCAACGTGAACCCCAAGTCTCC
CATCACAGAGCTCCTGGAGCAGAATGGAGGCTACGGGAGCGCCACACTGTCCCGAGGGCCACCCCCTCCC
GTGGGCCCCGCTGGCAGTGGCTACAGTGGAGGCCTGGCGCTGGCGGAGTACGACCAGCCGTATGGCGGCT
TCCTGGACATTCTGCGGGGTGGGACAGAGCGGCTCTTCACCAACCTCAAGGACACCTCCTCCAAGGTCAT
CCAGTCTGTCGCTAATTATGCAAAGGGTGACCTGGACATATCTTACATCACATCCAGAATTGCAGTGATG
TCATTCCCAGCAGAAGGTGTGGAGTCAGCGCTCAAAAACAACATCGAAGATGTGCGGTTGTTCCTGGACT
CCAAGCACCCAGGGCACTATGCCGTCTACAACCTGTCCCCGAGGACCTACCGGCCCTCCAGGTTCCACAA
CCGGGTCTCCGAGTGTGGCTGGGCAGCACGGCGGGCCCCACACCTGCACACCCTGTACAACATCTGCAGG
AACATGCACGCCTGGCTGCGGCAGGACCACAAGAACGTCTGCGTCGTGCACTGCATGGACGGGAGAGCCG
CGTCTGCTGTGGCCGTCTGCTCCTTCCTGTGCTTCTGCCGTCTCTTCAGCACCGCGGAGGCCGCCGTGTA
CATGTTCAGCATGAAGCGCTGCCCACCAGGCATCTGGCCATCCCACAAAAGGTACATCGAGTACATGTGT
GACATGGTGGCGGAGGAGCCCATCACACCCCACAGCAAGCCCATCCTGGTGAGGGCCGTGGTCATGACAC
CCGTGCCGCTGTTCAGCAAGCAGAGGAGCGGCTGCAGGCCCTTCTGCGAGGTCTACGTGGGGGACGAGCG
TGTGGCCAGCACCTCCCAGGAGTACGACAAGATGCGGGACTTTAAGATTGAAGATGGCAAAGCGGTGATT
CCCCTGGGCGTCACGGTGCAAGGAGACGTGCTCATCGTCATCTATCACGCCCGGTCCACTCTGGGCGGCC
GGCTGCAGGCCAAGATGGCATCCATGAAGATGTTCCAGATTCAGTTCCACACGGGGTTTGTGCCTCGGAA
CGCCACCACTGTGAAATTTGCCAAGTATGACCTGGACGCGTGTGACATTCAAGAAAAATACCCGGATTTA
TTTCAAGTGAACCTGGAAGTGGAGGTGGAGCCCAGGGACAGGCCGAGCCGGGAAGCCCCACCATGGGAGA
ACTCGAGCATGAGGGGGCTGAACCCCAAAATCCTGTTTTCCAGCCGGGAGGAGCAGCAAGACATTCTGTC
TAAGTTTGGGAAGCCGGAGCTTCCCCGGCAGCCTGGCTCCACGGCTCAGTATGATGCTGGGGCAGGGTCC
CCGGAAGCCGAACCCACAGACTCTGACTCACCGCCAAGCAGCAGCGCGGACGCCAGTCGCTTCCTGCACA
CGCTGGACTGGCAGGAAGAGAAGGAGGCAGAGACTGGTGCAGAAAATGCCTCTTCCAAGGAGAGCGAGTC
TGCCCTGATGGAGGACAGAGACGAGAGTGAGGTGTCAGATGAAGGGGGATCCCCGATCTCCAGCGAGGGC
CAGGAACCCAGGGCCGACCCAGAGCCCCCCGGCCTGGCAGCAGGGCTGGTGCAGCAGGACTTGGTTTTTG
AGGTGGAGACACCGGCTGTGCTGCCAGAGCCTGTGCCACAGGAAGACGGGGTCGACCTCCTGGGCCTGCA
CTCCGAGGTGGGCGCAGGGCCAGCTGTACCCCCGCAGGCCTGCAAGGCCCCCTCCAGCAACACCGACCTG
CTCAGCTGCCTCCTTGGGCCCCCTGAGGCCGCCTCCCAGGGGCCCCCGGAGGATCTGCTCAGCGAGGACC
CGCTGCTCCTGGCAAGCCCGGCCCCTCCCCTGAGCGTGCAGAGCACCCCAAGAGGAGGGCCCCCTGCCGC
TGCTGACCCCTTTGGCCCGCTTCTGCCGTCTTCAGGCAACAACTCCCAGCCCTGCTCCAATCCTGATCTC
TTCGGCGAATTTCTCAATTCGGACTCTGTGACCGTCCCACCATCCTTCCCGTCTGCCCACAGCGCTCCGC
CCCCATCCTGCAGCGCCGACTTCCTGCACCTGGGGGATCTGCCAGGAGAGCCCAGCAAGATGACAGCCTC
GTCCAGCAACCCAGACCTGCTGGGAGGATGGGCTGCCTGGACCGAGACTGCAGCGTCGGCAGTGGCCCCC
ACGCCAGCCACAGAAGGCCCCCTCTTCTCTCCTGGAGGTCAGCCGGCCCCTTGTGGCTCTCAGGCCAGCT
GGACCAAGTCTCAGAACCCGGACCCATTTGCTGACCTTGGCGACCTCAGCTCCGGCCTCCAAGGCTCACC
AGCTGGATTCCCTCCTGGGGGCTTCATTCCCAAAACGGCCACCACGCCCAAAGGCAGCAGCTCCTGGCAG
ACAAGTCGGCCGCCAGCCCAGGGCGCCTCATGGCCCCCTCAGGCCAAGCCGCCCCCCAAAGCCTGCACAC
AGCCAAGGCCTAACTATGCCTCGAACTTCAGTGTGATCGGGGCGCGGGAGGAGCGGGGGGTCCGCGCACC
CAGCTTTGCTCAAAAGCCAAAAGTCTCTGAGAACGACTTTGAAGATCTGTTGTCCAATCAAGGCTTCTCC
TCCAGGTCTGACAAGAAAGGGCCAAAGACCATTGCAGAGATGAGGAAGCAGGACCTGGCTAAAGACACGG
ACCCACTCAAGCTGAAGCTCCTGGACTGGATTGAGGGCAAGGAGCGGAACATCCGGGCCCTGCTGTCCAC
GCTGCACACAGTGCTGTGGGACGGGGAGAGCCGCTGGACGCCCGTGGGCATGGCCGACCTGGTGGCTCCG
GAGCAAGTGAAGAAGCACTATCGCCGCGCGGTGCTGGCCGTGCACCCCGACAAGGCTGCGGGGCAGCCGT
ACGAGCAGCACGCCAAGATGATCTTCATGGAGCTGAATGACGCCTGGTCGGAGTTTGAGAACCAGGGCTC
CCGGCCCCTCTTC


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
>RC223572 representing NM_005255
Red=Cloning site Green=Tags(s)

MSLLQSALDFLAGPGSLGGASGRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDVGSGREYALKR
LLSNEEEKNRAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQAEFLLLTELCKGQLVEFLKKMESR
GPLSCDTVLKIFYQTCRAVQHMHRQKPPIIHRDLKVENLLLSNQGTIKLCDFGSATTISHYPDYSWSAQR
RALVEEEITRNTTPMYRTPEIIDLYSNFPIGEKQDIWALGCILYLLCFRQHPFEDGAKLRIVNGKYSIPP
HDTQYTVFHSLIRAMLQVNPEERLSIAEVVHQLQEIAAARNVNPKSPITELLEQNGGYGSATLSRGPPPP
VGPAGSGYSGGLALAEYDQPYGGFLDILRGGTERLFTNLKDTSSKVIQSVANYAKGDLDISYITSRIAVM
SFPAEGVESALKNNIEDVRLFLDSKHPGHYAVYNLSPRTYRPSRFHNRVSECGWAARRAPHLHTLYNICR
NMHAWLRQDHKNVCVVHCMDGRAASAVAVCSFLCFCRLFSTAEAAVYMFSMKRCPPGIWPSHKRYIEYMC
DMVAEEPITPHSKPILVRAVVMTPVPLFSKQRSGCRPFCEVYVGDERVASTSQEYDKMRDFKIEDGKAVI
PLGVTVQGDVLIVIYHARSTLGGRLQAKMASMKMFQIQFHTGFVPRNATTVKFAKYDLDACDIQEKYPDL
FQVNLEVEVEPRDRPSREAPPWENSSMRGLNPKILFSSREEQQDILSKFGKPELPRQPGSTAQYDAGAGS
PEAEPTDSDSPPSSSADASRFLHTLDWQEEKEAETGAENASSKESESALMEDRDESEVSDEGGSPISSEG
QEPRADPEPPGLAAGLVQQDLVFEVETPAVLPEPVPQEDGVDLLGLHSEVGAGPAVPPQACKAPSSNTDL
LSCLLGPPEAASQGPPEDLLSEDPLLLASPAPPLSVQSTPRGGPPAAADPFGPLLPSSGNNSQPCSNPDL
FGEFLNSDSVTVPPSFPSAHSAPPPSCSADFLHLGDLPGEPSKMTASSSNPDLLGGWAAWTETAASAVAP
TPATEGPLFSPGGQPAPCGSQASWTKSQNPDPFADLGDLSSGLQGSPAGFPPGGFIPKTATTPKGSSSWQ
TSRPPAQGASWPPQAKPPPKACTQPRPNYASNFSVIGAREERGVRAPSFAQKPKVSENDFEDLLSNQGFS
SRSDKKGPKTIAEMRKQDLAKDTDPLKLKLLDWIEGKERNIRALLSTLHTVLWDGESRWTPVGMADLVAP
EQVKKHYRRAVLAVHPDKAAGQPYEQHAKMIFMELNDAWSEFENQGSRPLF

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_005255
ORF Size 3933 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_005255.4
RefSeq Size 4331 bp
RefSeq ORF 3936 bp
Locus ID 2580
UniProt ID O14976
Cytogenetics 4p16.3
Domains pkinase, TyrKc, DnaJ, S_TKc
Protein Families Druggable Genome, Protein Kinase
MW 143 kDa
Gene Summary In all eukaryotes, the cell cycle is governed by cyclin-dependent protein kinases (CDKs), whose activities are regulated by cyclins and CDK inhibitors in a diverse array of mechanisms that involve the control of phosphorylation and dephosphorylation of Ser, Thr or Tyr residues. Cyclins are molecules that possess a consensus domain called the 'cyclin box.' In mammalian cells, 9 cyclin species have been identified, and they are referred to as cyclins A through I. Cyclin G is a direct transcriptional target of the p53 tumor suppressor gene product and thus functions downstream of p53. GAK is an association partner of cyclin G and CDK5. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Dec 2015]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.