TAL1 (NM_003189) Human Tagged ORF Clone

CAT#: RC222628

Reviews ()
Write a review

TAL1 (Myc-DDK-tagged)-Human T-cell acute lymphocytic leukemia 1 (TAL1)



  "NM_003189" in other vectors (6)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 300.00


Availability*
In Stock

Size
    • 10 ug


Product images

Other products for "TAL1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol TAL1
Synonyms bHLHa17; SCL; tal-1; TCL5
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC222628 representing NM_003189
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACCGAGCGGCCGCCGAGCGAGGCGGCTCGCAGTGACCCCCAGCTAGAGGGACGGGACGCGGCCGAGG
CCAGCATGGCCCCCCCGCACCTGGTCCTGCTGAACGGCGTCGCCAAGGAGACGAGCCGCGCGGCCGCAGC
GGAGCCCCCAGTCATCGAACTGGGCGCGCGCGGAGGCCCGGGGGGCGGCCCTGCCGGTGGGGGCGGCGCC
GCGAGAGACTTAAAGGGCCGCGACGCGGCGACGGCCGAAGCGCGCCATCGGGTGCCCACCACCGAGCTGT
GCAGACCTCCCGGGCCCGCCCCGGCCCCCGCGCCCGCCTCGGTTACAGCGGAGCTGCCCGGCGACGGCCG
CATGGTGCAGCTGAGTCCTCCCGCGCTGGCTGCCCCCGCCGCCCCCGGCCGCGCGCTGCTCTACAGCCTC
AGCCAGCCGCTGGCCTCTCTCGGCAGCGGGTTCTTTGGGGAGCCGGATGCCTTCCCTATGTTCACCACCA
ACAATCGAGTGAAGAGGAGACCTTCCCCCTATGAGATGGAGATTACTGATGGTCCCCACACCAAAGTTGT
GCGGCGTATCTTCACCAACAGCCGGGAGCGATGGCGGCAGCAGAATGTGAACGGGGCCTTTGCCGAGCTC
CGCAAGCTGATCCCCACACATCCCCCGGACAAGAAGCTCAGCAAGAATGAGATCCTCCGCCTGGCCATGA
AGTATATCAACTTCTTGGCCAAGCTGCTCAATGACCAGGAGGAGGAGGGCACCCAGCGGGCCAAGACTGG
CAAGGACCCTGTGGTGGGGGCTGGTGGGGGTGGAGGTGGGGGAGGGGGTGGCGCGCCCCCAGATGACCTC
CTGCAAGACGTGCTTTCCCCCAACTCCAGCTGCGGCAGCTCCCTGGATGGGGCAGCCAGCCCGGACAGCT
ACACGGAGGAGCCCGCGCCCAAGCACACGGCCCGCAGCCTCCATCCTGCCATGCTGCCTGCCGCCGATGG
AGCCGGCCCTCGG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC222628 representing NM_003189
Red=Cloning site Green=Tags(s)

MTERPPSEAARSDPQLEGRDAAEASMAPPHLVLLNGVAKETSRAAAAEPPVIELGARGGPGGGPAGGGGA
ARDLKGRDAATAEARHRVPTTELCRPPGPAPAPAPASVTAELPGDGRMVQLSPPALAAPAAPGRALLYSL
SQPLASLGSGFFGEPDAFPMFTTNNRVKRRPSPYEMEITDGPHTKVVRRIFTNSRERWRQQNVNGAFAEL
RKLIPTHPPDKKLSKNEILRLAMKYINFLAKLLNDQEEEGTQRAKTGKDPVVGAGGGGGGGGGGAPPDDL
LQDVLSPNSSCGSSLDGAASPDSYTEEPAPKHTARSLHPAMLPAADGAGPR

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_003189
ORF Size 993 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_003189.5
RefSeq Size 5000 bp
RefSeq ORF 996 bp
Locus ID 6886
UniProt ID P17542
Cytogenetics 1p33
Domains HLH
Protein Families Adult stem cells, Druggable Genome, ES Cell Differentiation/IPS, Transcription Factors
MW 34.1 kDa
Gene Summary Implicated in the genesis of hemopoietic malignancies. It may play an important role in hemopoietic differentiation. Serves as a positive regulator of erythroid differentiation (By similarity).[UniProtKB/Swiss-Prot Function]

Other Versions

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.