IL12RB1 (NM_005535) Human Tagged ORF Clone

CAT#: RC221974

Reviews ()
Write a review

IL12RB1 (Myc-DDK-tagged)-Human interleukin 12 receptor, beta 1 (IL12RB1), transcript variant 1



  "NM_005535" in other vectors (6)

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 477.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol IL12RB1
Synonyms CD212; IL-12R-BETA1; IL12RB; IMD30
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC221974 representing NM_005535
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGCCGCTGGTGACCTGGGTGGTCCCCCTCCTCTTCCTCTTCCTGCTGTCCAGGCAGGGCGCTGCCT
GCAGAACCAGTGAGTGCTGTTTTCAGGACCCGCCATATCCGGATGCAGACTCAGGCTCGGCCTCGGGCCC
TAGGGACCTGAGATGCTATCGGATATCCAGTGATCGTTACGAGTGCTCCTGGCAGTATGAGGGTCCCACA
GCTGGGGTCAGCCACTTCCTGCGGTGTTGCCTTAGCTCCGGGCGCTGCTGCTACTTCGCCGCCGGCTCAG
CCACCAGGCTGCAGTTCTCCGACCAGGCTGGGGTGTCTGTGCTGTACACTGTCACACTCTGGGTGGAATC
CTGGGCCAGGAACCAGACAGAGAAGTCTCCTGAGGTCACCCTGCAGCTCTACAACTCAGTTAAATATGAG
CCTCCTCTGGGAGACATCAAGGTGTCCAAGTTGGCCGGGCAGCTGCGTATGGAGTGGGAGACCCCGGATA
ACCAGGTTGGTGCTGAGGTGCAGTTCCGGCACCGGACACCCAGCAGCCCATGGAAGTTGGGCGACTGCGG
ACCTCAGGATGATGATACTGAGTCCTGCCTCTGCCCCCTGGAGATGAATGTGGCCCAGGAATTCCAGCTC
CGACGACGGCGGCTGGGGAGCCAAGGAAGTTCCTGGAGCAAGTGGAGCAGCCCTGTGTGCGTTCCCCCTG
AAAACCCCCCACAGCCTCAGGTGAGATTCTCGGTGGAGCAGCTGGGCCAGGATGGGAGGAGGCGGCTGAC
CCTGAAAGAGCAGCCAACCCAGCTGGAGCTTCCAGAAGGCTGTCAAGGGCTGGCGCCTGGCACGGAGGTC
ACTTACCGACTACAGCTCCACATGCTGTCCTGCCCGTGTAAGGCCAAGGCCACCAGGACCCTGCACCTGG
GGAAGATGCCCTATCTCTCGGGTGCTGCCTACAACGTGGCTGTCATCTCCTCGAACCAATTTGGTCCTGG
CCTGAACCAGACGTGGCACATTCCTGCCGACACCCACACAGAACCAGTGGCTCTGAATATCAGCGTCGGA
ACCAACGGGACCACCATGTATTGGCCAGCCCGGGCTCAGAGCATGACGTATTGCATTGAATGGCAGCCTG
TGGGCCAGGACGGGGGCCTTGCCACCTGCAGCCTGACTGCGCCGCAAGACCCGGATCCGGCTGGAATGGC
AACCTACAGCTGGAGTCGAGAGTCTGGGGCAATGGGGCAGGAAAAGTGTTACTACATTACCATCTTTGCC
TCTGCGCACCCCGAGAAGCTCACCTTGTGGTCTACGGTCCTGTCCACCTACCACTTTGGGGGCAATGCCT
CAGCAGCTGGGACACCGCACCACGTCTCGGTGAAGAATCATAGCTTGGACTCTGTGTCTGTGGACTGGGC
ACCATCCCTGCTGAGCACCTGTCCCGGCGTCCTAAAGGAGTATGTTGTCCGCTGCCGAGATGAAGACAGC
AAACAGGTGTCAGAGCATCCCGTGCAGCCCACAGAGACCCAAGTTACCCTCAGTGGCCTGCGGGCTGGTG
TAGCCTACACGGTGCAGGTGCGAGCAGACACAGCGTGGCTGAGGGGTGTCTGGAGCCAGCCCCAGCGCTT
CAGCATCGAAGTGCAGGTTTCTGATTGGCTCATCTTCTTCGCCTCCCTGGGGAGCTTCCTGAGCATCCTT
CTCGTGGGCGTCCTTGGCTACCTTGGCCTGAACAGGGCCGCACGGCACCTGTGCCCGCCGCTGCCCACAC
CCTGTGCCAGCTCCGCCATTGAGTTCCCTGGAGGGAAGGAGACTTGGCAGTGGATCAACCCAGTGGACTT
CCAGGAAGAGGCATCCCTGCAGGAGGCCCTGGTGGTAGAGATGTCCTGGGACAAAGGCGAGAGGACTGAG
CCTCTCGAGAAGACAGAGCTACCTGAGGGTGCCCCTGAGCTGGCCCTGGATACAGAGTTGTCCTTGGAGG
ATGGAGACAGGTGCAAGGCCAAGATG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC221974 representing NM_005535
Red=Cloning site Green=Tags(s)

MEPLVTWVVPLLFLFLLSRQGAACRTSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPT
AGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVESWARNQTEKSPEVTLQLYNSVKYE
PPLGDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSPWKLGDCGPQDDDTESCLCPLEMNVAQEFQL
RRRRLGSQGSSWSKWSSPVCVPPENPPQPQVRFSVEQLGQDGRRRLTLKEQPTQLELPEGCQGLAPGTEV
TYRLQLHMLSCPCKAKATRTLHLGKMPYLSGAAYNVAVISSNQFGPGLNQTWHIPADTHTEPVALNISVG
TNGTTMYWPARAQSMTYCIEWQPVGQDGGLATCSLTAPQDPDPAGMATYSWSRESGAMGQEKCYYITIFA
SAHPEKLTLWSTVLSTYHFGGNASAAGTPHHVSVKNHSLDSVSVDWAPSLLSTCPGVLKEYVVRCRDEDS
KQVSEHPVQPTETQVTLSGLRAGVAYTVQVRADTAWLRGVWSQPQRFSIEVQVSDWLIFFASLGSFLSIL
LVGVLGYLGLNRAARHLCPPLPTPCASSAIEFPGGKETWQWINPVDFQEEASLQEALVVEMSWDKGERTE
PLEKTELPEGAPELALDTELSLEDGDRCKAKM

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_005535
ORF Size 1986 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_005535.3
RefSeq Size 2100 bp
RefSeq ORF 1989 bp
Locus ID 3594
UniProt ID P42701
Cytogenetics 19p13.11
Protein Families Druggable Genome, Transmembrane
Protein Pathways Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway
MW 73.14 kDa
Gene Summary The protein encoded by this gene is a type I transmembrane protein that belongs to the hemopoietin receptor superfamily. This protein binds to interleukine 12 (IL12) with a low affinity, and is thought to be a part of IL12 receptor complex. This protein forms a disulfide-linked oligomer, which is required for its IL12 binding activity. The coexpression of this and IL12RB2 proteins was shown to lead to the formation of high-affinity IL12 binding sites and reconstitution of IL12 dependent signaling. Mutations in this gene impair the development of interleukin-17-producing T lymphocytes and result in increased susceptibility to mycobacterial and Salmonella infections. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2014]

Other Versions

Other products for "IL12RB1"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


IL12RB1 mouse monoclonal antibody, clone OTI1A6 (formerly 1A6)
    • 100 ul

USD 417.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.