HIPK2 (NM_022740) Human Tagged ORF Clone

CAT#: RC220278

Reviews ()
Write a review

HIPK2 (Myc-DDK-tagged)-Human homeodomain interacting protein kinase 2 (HIPK2), transcript variant 1



  "NM_022740" in other vectors (8)

Reconstitution Protocol

USD 1,043.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "HIPK2"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol HIPK2
Synonyms PRO0593
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC220278 representing NM_022740
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCCCCGTGTACGAAGGTATGGCCTCACATGTGCAAGTTTTCTCCCCTCACACCCTTCAATCAAGTG
CCTTCTGTAGTGTGAAGAAACTGAAAATAGAGCCGAGTTCCAACTGGGACATGACTGGGTACGGCTCCCA
CAGCAAAGTGTATAGCCAGAGCAAGAACATCCCCCTGTCGCAGCCAGCCACCACAACCGTCAGCACCTCC
TTGCCGGTCCCAAACCCAAGCCTACCTTACGAGCAGACCATCGTCTTCCCAGGAAGCACCGGGCACATCG
TGGTCACCTCAGCAAGCAGCACTTCTGTCACCGGGCAAGTCCTCGGCGGACCACACAACCTAATGCGTCG
AAGCACTGTGAGCCTCCTTGATACCTACCAAAAATGTGGACTCAAGCGTAAGAGCGAGGAGATCGAGAAC
ACAAGCAGCGTGCAGATCATCGAGGAGCATCCACCCATGATTCAGAATAATGCAAGCGGGGCCACTGTCG
CCACTGCCACCACGTCTACTGCCACCTCCAAAAACAGCGGCTCCAACAGCGAGGGCGACTATCAGCTGGT
GCAGCATGAGGTGCTGTGCTCCATGACCAACACCTACGAGGTCTTAGAGTTCTTGGGCCGAGGGACGTTT
GGGCAAGTGGTCAAGTGCTGGAAACGGGGCACCAATGAGATCGTAGCCATCAAGATCCTGAAGAACCACC
CATCCTATGCCCGACAAGGTCAGATTGAAGTGAGCATCCTGGCCCGGTTGAGCACGGAGAGTGCCGATGA
CTATAACTTCGTCCGGGCCTACGAATGCTTCCAGCACAAGAACCACACGTGCTTGGTCTTCGAGATGTTG
GAGCAGAACCTCTATGACTTTCTGAAGCAAAACAAGTTTAGCCCCTTGCCCCTCAAATACATTCGCCCAG
TTCTCCAGCAGGTAGCCACAGCCCTGATGAAACTCAAAAGCCTAGGTCTTATCCACGCTGACCTCAAACC
AGAAAACATCATGCTGGTGGATCCATCTAGACAACCATACAGAGTCAAGGTCATCGACTTTGGTTCAGCC
AGCCACGTGTCCAAGGCTGTGTGCTCCACCTACTTGCAGTCCAGATATTACAGGGCCCCTGAGATCATCC
TTGGTTTACCATTTTGTGAGGCAATTGACATGTGGTCCCTGGGCTGTGTTATTGCAGAATTGTTCCTGGG
TTGGCCGTTATATCCAGGAGCTTCGGAGTATGATCAGATTCGGTATATTTCACAAACACAGGGTTTGCCT
GCTGAATATTTATTAAGCGCCGGGACAAAGACAACTAGGTTTTTCAACCGTGACACGGACTCACCATATC
CTTTGTGGAGACTGAAGACACCAGATGACCATGAAGCAGAGACAGGGATTAAGTCAAAAGAAGCAAGAAA
GTACATTTTCAACTGTTTAGATGATATGGCCCAGGTGAACATGACGACAGATTTGGAAGGGAGCGACATG
TTGGTAGAAAAGGCTGACCGGCGGGAGTTCATTGACCTGTTGAAGAAGATGCTGACCATTGATGCTGACA
AGAGAATCACTCCAATCGAAACCCTGAACCATCCCTTTGTCACCATGACACACTTACTCGATTTTCCCCA
CAGCACACACGTCAAATCATGTTTCCAGAACATGGAGATCTGCAAGCGTCGGGTGAATATGTATGACACG
GTGAACCAGAGCAAAACCCCTTTCATCACGCACGTGGCCCCCAGCACGTCCACCAACCTGACCATGACCT
TTAACAACCAGCTGACCACTGTCCACAACCAGGCTCCCTCCTCTACCAGTGCCACTATTTCCTTAGCCAA
TCCCGAAGTCTCCATACTAAACTACCCATCTACACTCTACCAGCCCTCAGCGGCATCCATGGCTGCAGTG
GCCCAGCGGAGCATGCCCCTGCAGACAGGAACAGCCCAGATTTGTGCCCGGCCTGACCCGTTCCAGCAAG
CTCTCATCGTGTGTCCCCCCGGCTTCCAAGGCTTGCAGGCCTCTCCCTCTAAGCACGCTGGCTACTCGGT
GCGAATGGAAAATGCAGTTCCCATCGTCACTCAAGCCCCAGGAGCTCAGCCTCTTCAGATCCAACCAGGT
CTGCTTGCCCAGCAGGCTTGGCCAAGTGGGACCCAGCAGATCCTGCTTCCCCCAGCATGGCAGCAACTGA
CTGGAGTGGCCACCCACACATCAGTGCAGCATGCCACCGTGATTCCCGAGACCATGGCAGGCACCCAGCA
GCTGGCGGACTGGAGAAATACGCATGCTCACGGAAGCCATTATAATCCCATCATGCAGCAGCCTGCACTA
TTGACCGGTCATGTGACCCTTCCAGCAGCACAGCCCTTAAATGTGGGTGTGGCCCACGTGATGCGGCAGC
AGCCAACCAGCACCACCTCCTCCCGGAAGAGTAAGCAGCACCAGTCATCTGTGAGAAATGTCTCCACCTG
TGAGGTGTCCTCCTCTCAGGCCATCAGCTCCCCACAGCGATCCAAGCGTGTCAAGGAGAACACACCTCCC
CGCTGTGCCATGGTGCACAGTAGCCCGGCCTGCAGCACCTCGGTCACCTGTGGGTGGGGCGACGTGGCCT
CCAGCACCACCCGGGAACGGCAGCGGCAGACAATTGTCATTCCCGACACTCCCAGCCCCACGGTCAGCGT
CATCACCATCAGCAGTGACACGGACGAGGAGGAGGAACAGAAACACGCCCCCACCAGCACTGTCTCCAAG
CAAAGAAAAAACGTCATCAGCTGTGTCACAGTCCACGACTCCCCCTACTCCGACTCCTCCAGCAACACCA
GCCCCTACTCCGTGCAGCAGCGTGCTGGGCACAACAATGCCAATGCCTTTGACACCAAGGGGAGCCTGGA
GAATCACTGCACGGGGAACCCCCGAACCATCATCGTGCCACCCCTGAAAACCCAGGCCAGCGAAGTATTG
GTGGAGTGTGATAGCCTGGTGCCAGTCAACACCAGTCACCACTCGTCCTCCTACAAGTCCAAGTCCTCCA
GCAACGTGACCTCCACCAGCGGTCACTCTTCAGGGAGCTCATCTGGAGCCATCACCTACCGGCAGCAGCG
GCCGGGCCCCCACTTCCAGCAGCAGCAGCCACTCAATCTCAGCCAGGCTCAGCAGCACATCACCACGGAC
CGCACTGGGAGCCACCGAAGGCAGCAGGCCTACATCACTCCCACCATGGCCCAGGCTCCGTACTCCTTCC
CGCACAACAGCCCCAGCCACGGCACTGTGCACCCGCATCTGGCTGCAGCCGCTGCCGCTGCCCACCTCCC
CACCCAGCCCCACCTCTACACCTACACTGCGCCGGCGGCCCTGGGCTCCACCGGCACCGTGGCCCACCTG
GTGGCCTCGCAAGGCTCTGCGCGCCACACCGTGCAGCACACTGCCTACCCAGCCAGCATCGTCCACCAGG
TCCCCGTGAGCATGGGCCCCCGGGTCCTGCCCTCGCCCACCATCCACCCGAGTCAGTATCCAGCCCAATT
TGCCCACCAGACCTACATCAGCGCCTCGCCAGCCTCCACCGTCTACACTGGATACCCACTGAGCCCCGCC
AAGGTCAACCAGTACCCTTACATA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC220278 representing NM_022740
Red=Cloning site Green=Tags(s)

MAPVYEGMASHVQVFSPHTLQSSAFCSVKKLKIEPSSNWDMTGYGSHSKVYSQSKNIPLSQPATTTVSTS
LPVPNPSLPYEQTIVFPGSTGHIVVTSASSTSVTGQVLGGPHNLMRRSTVSLLDTYQKCGLKRKSEEIEN
TSSVQIIEEHPPMIQNNASGATVATATTSTATSKNSGSNSEGDYQLVQHEVLCSMTNTYEVLEFLGRGTF
GQVVKCWKRGTNEIVAIKILKNHPSYARQGQIEVSILARLSTESADDYNFVRAYECFQHKNHTCLVFEML
EQNLYDFLKQNKFSPLPLKYIRPVLQQVATALMKLKSLGLIHADLKPENIMLVDPSRQPYRVKVIDFGSA
SHVSKAVCSTYLQSRYYRAPEIILGLPFCEAIDMWSLGCVIAELFLGWPLYPGASEYDQIRYISQTQGLP
AEYLLSAGTKTTRFFNRDTDSPYPLWRLKTPDDHEAETGIKSKEARKYIFNCLDDMAQVNMTTDLEGSDM
LVEKADRREFIDLLKKMLTIDADKRITPIETLNHPFVTMTHLLDFPHSTHVKSCFQNMEICKRRVNMYDT
VNQSKTPFITHVAPSTSTNLTMTFNNQLTTVHNQAPSSTSATISLANPEVSILNYPSTLYQPSAASMAAV
AQRSMPLQTGTAQICARPDPFQQALIVCPPGFQGLQASPSKHAGYSVRMENAVPIVTQAPGAQPLQIQPG
LLAQQAWPSGTQQILLPPAWQQLTGVATHTSVQHATVIPETMAGTQQLADWRNTHAHGSHYNPIMQQPAL
LTGHVTLPAAQPLNVGVAHVMRQQPTSTTSSRKSKQHQSSVRNVSTCEVSSSQAISSPQRSKRVKENTPP
RCAMVHSSPACSTSVTCGWGDVASSTTRERQRQTIVIPDTPSPTVSVITISSDTDEEEEQKHAPTSTVSK
QRKNVISCVTVHDSPYSDSSSNTSPYSVQQRAGHNNANAFDTKGSLENHCTGNPRTIIVPPLKTQASEVL
VECDSLVPVNTSHHSSSYKSKSSSNVTSTSGHSSGSSSGAITYRQQRPGPHFQQQQPLNLSQAQQHITTD
RTGSHRRQQAYITPTMAQAPYSFPHNSPSHGTVHPHLAAAAAAAHLPTQPHLYTYTAPAALGSTGTVAHL
VASQGSARHTVQHTAYPASIVHQVPVSMGPRVLPSPTIHPSQYPAQFAHQTYISASPASTVYTGYPLSPA
KVNQYPYI

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_022740
ORF Size 3594 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_022740.3, NP_073577.3
RefSeq Size 15148 bp
RefSeq ORF 3597 bp
Locus ID 28996
UniProt ID Q9H2X6
Cytogenetics 7q34
Domains pkinase, TyrKc, S_TKc
Protein Families Druggable Genome, Protein Kinase, Transcription Factors
MW 130.8 kDa
Gene Summary This gene encodes a conserved serine/threonine kinase that is a member of the homeodomain-interacting protein kinase family. The encoded protein interacts with homeodomain transcription factors and many other transcription factors such as p53, and can function as both a corepressor and a coactivator depending on the transcription factor and its subcellular localization. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2011]

Other Versions

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.