RASGRF1 (NM_002891) Human Tagged ORF Clone

CAT#: RC219147

Reviews ()
Write a review

RASGRF1 (Myc-DDK-tagged)-Human Ras protein-specific guanine nucleotide-releasing factor 1 (RASGRF1), transcript variant 1



  "NM_002891" in other vectors (4)

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 1,518.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol RASGRF1
Synonyms CDC25; CDC25L; GNRP; GRF1; GRF55; H-GRF55; PP13187; ras-GRF1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC219147 representing NM_002891
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAGAAGGGGATCCGGCTGAATGATGGCCACGTCGCGTCCCTGGGACTGCTGGCGCGCAAGGACGGCA
CGCGCAAAGGCTACCTGAGCAAGCGGAGTTCGGACAACACAAAATGGCAAACCAAGTGGTTCGCGCTGCT
GCAGAACCTGCTCTTCTACTTCGAGAGCGACTCGAGCTCGCGGCCCTCGGGGCTTTACCTGCTGGAGGGC
TGCGTCTGCGACCGCGCGCCCTCCCCCAAGCCGGCGCTGTCGGCCAAGGAGCCGCTGGAGAAACAGCATT
ACTTCACGGTGAACTTCAGCCATGAGAACCAGAAAGCCTTGGAGCTGAGGACAGAGGACGCAAAAGATTG
TGACGAATGGGTGGCAGCCATTGCACATGCCAGCTACAGGACCCTCGCCACAGAGCATGAGGCATTAATG
CAGAAATACCTGCACCTGCTGCAGATCGTGGAGACAGAGAAGACCGTGGCCAAGCAGCTTCGGCAGCAGA
TCGAGGATGGGGAGATCGAGATCGAGCGGCTGAAGGCAGAGATCACATCCCTGCTCAAGGACAATGAGCG
CATCCAGTCCACCCAGACTGTCGCCCCCAACGATGAAGACAGCGACATCAAGAAAATTAAGAAGGTGCAG
AGCTTCCTGCGGGGCTGGCTGTGCCGGCGGAAGTGGAAGACCATCATCCAGGACTACATCCGGTCACCCC
ATGCTGACAGCATGCGCAAGAGGAACCAGGTGGTGTTCAGCATGCTGGAGGCTGAGGCTGAGTACGTGCA
GCAGCTGCACATCCTTGTCAACAATTTCCTGCGCCCGCTGCGGATGGCCGCCAGCTCCAAGAAGCCTCCC
ATCACACACGACGACGTCAGCAGCATCTTCCTGAACAGCGAAACCATCATGTTTTTACATCAGATCTTTT
ACCAAGGCCTGAAGGCCCGCATCTCCAGCTGGCCCACGCTGGTCCTGGCTGACCTATTTGACATCCTGCT
GCCCATGCTCAACATCTACCAAGAGTTCGTCCGCAACCACCAGTACAGCCTGCAGATCCTGGCCCACTGC
AAGCAGAACCGTGACTTCGACAAGCTGCTGAAGCACTACGAGGCCAAGCCTGACTGCGAGGAGAGGACGC
TGGAGACCTTCCTCACCTACCCCATGTTCCAGATCCCCAGGTACATCCTGACCCTCCATGAGCTCCTGGC
CCACACGCCTCATGAGCACGTTGAGCGCAACAGCCTGGACTACGCCAAGTCCAAACTGGAGGAGCTGTCC
AGAATAATGCACGATGAAGTAAGTGAGACGGAGAACATCCGGAAAAACCTGGCCATCGAGCGCATGATCA
TCGAAGGCTGTGAGATCCTCCTGGACACCAGCCAGACCTTTGTGAGACAAGGTTCCCTCATTCAGGTGCC
CATGTCTGAAAAGGGCAAGATCACCAGGGGGCGCCTGGGGTCTCTCTCCCTAAAGAAAGAGGGCGAGCGA
CAGTGCTTCCTGTTTTCTAAGCATCTGATTATCTGTACCAGAGGCTCTGGAGGGAAGCTTCACTTGACCA
AGAATGGAGTCATATCCCTCATTGACTGCACTTTATTGGAGGAGCCAGAAAGCACGGAGGAGGAAGCCAA
AGGATCCGGCCAAGACATAGATCACTTGGATTTTAAAATCGGGGTGGAGCCAAAGGATTCCCCGCCCTTT
ACAGTCATCCTAGTGGCCTCGTCCAGACAGGAGAAGGCAGCGTGGACCAGTGACATCAGCCAGTGTGTGG
ATAACATCCGATGCAATGGGCTCATGATGAACGCATTTGAAGAAAATTCCAAGGTCACTGTGCCGCAGAT
GATCAAGAGGACCAGGGAGGGGACCAGGGAAGCAGAAATGAGCAGGTCCGACGCCTCCTTATATTGTGAT
GATGTTGACATTCGCTTCAGCAAAACCATGAACTCCTGCAAAGTGCTGCAGATCCGCTACGCCAGTGTGG
AGCGGCTGCTGGAGAGGCTGACGGACCTGCGCTTCCTGAGCATCGACTTCCTCAACACCTTCCTGCACTC
CTACCGCGTCTTCACCACCGCCATCGTGGTCCTGGACAAGCTCATTACCATCTACAAGAAGCCTATCAGT
GCCATTCCTGCCAGGTGGCTGAGGTCGCTGGAGCTCCTGTTTGCCAGTGGCCAGAACAATAAGCTCCTGT
ACGGTGAACCCCCCAAGTCCCCGCGCGCCACCCGCAAGTTCTCCTCGCCGCCACCTCTGTCCATCACCAA
GACATCGTCACCGAGCCGCCGGCGGAAGCTCTCCCTGAACATCCCCATCATCACTGGCGGCAAGGCCCTG
GACCTGGCCGCCCTCAGCTGCAACTCCAATGGCTACACCAGCATGTACTCGGCCATGTCACCCTTCAGCA
AGGCCACGCTGGACACCAGCAAGCTCTATGTGTCCAGCAGCTTCACCAACAAGATTCCAGATGAGGGCGA
TACGACCCCTGAGAAGCCCGAAGACCCTTCAGCGCTCAGCAAGCAGAGCTCAGAAGTCTCCATGAGAGAG
GAGTCAGATATTGATCAAAACCAGAGTGATGATGGTGATACTGAAACATCACCAACTAAATCTCCAACAA
CACCCAAATCAGTCAAAAACAAAAATTCTTCAGAGTTCCCACTCTTTTCCTATAACAATGGAGTCGTCAT
GACCTCCTGTCGTGAACTGGACAATAACCGCAGTGCCTTGTCGGCCGCCTCTGCCTTTGCCATAGCAACC
GCCGGGGCCAACGAGGGCACCCCAAACAAGGAGAAGTACCGGAGGATGTCCTTAGCCAGTGCAGGGTTTC
CCCCAGACCAGAGGAATGGAGACAAGGAGTTTGTGATCCGCAGAGCAGCCACCAATCGTGTCTTGAACGT
GCTCCGCCACTGGGTGTCCAAGCACTCTCAGGACTTTGAGACCAACGATGAGCTCAAATGCAAGGTGATC
GGCTTCCTGGAAGAAGTCATGCACGACCCGGAGCTCCTGACCCAGGAGCGGAAGGCTGCAGCCAACATCA
TCAGGACTCTGACCCAGGAGGACCCAGGTGACAACCAGATCACGCTGGAGGAGATCACGCAGATGGCTGA
AGGCGTGAAGGCTGAGCCCTTTGAAAACCACTCAGCCCTGGAGATCGCGGAGCAGCTGACCCTGCTAGAT
CACCTCGTCTTCAAGAAGATTCCTTATGAGGAGTTCTTCGGACAAGGATGGATGAAACTGGAAAAGAATG
AAAGGACCCCTTATATCATGAAAACCACTAAGCACTTCAATGACATCAGTAACTTGATTGCTTCAGAAAT
CATCCGCAATGAGGACATCAACGCCAGGGTGAGCGCCATCGAGAAGTGGGTGGCCGTAGCTGACATATGC
CGCTGCCTCCACAACTACAATGCCGTACTGGAGATCACCTCGTCCATGAACCGCAGTGCAATCTTCCGGC
TCAAAAAGACGTGGCTCAAAGTCTCTAAGCAGACTAAAGCTTTGATTGATAAGCTCCAAAAGCTTGTGTC
ATCTGAGGGCAGATTTAAGAATCTCAGAGAAGCTCTGAAAAATTGTGACCCACCCTGTGTCCCTTACCTG
GGGATGTACCTCACCGACCTGGCCTTCATCGAGGAGGGGACGCCCAATTACACGGAAGACGGCCTGGTCA
ACTTCTCCAAGATGAGGATGATATCCCATATTATCCGAGAGATTCGCCAGTTTCAACAAACTGCCTACAA
AATAGAGCACCAAGCAAAGGTAACGCAATATTTACTGGACCAATCTTTTGTAATGGATGAAGAAAGCCTC
TACGAGTCTTCTCTCCGAATAGAACCAAAACTCCCCACC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC219147 representing NM_002891
Red=Cloning site Green=Tags(s)

MQKGIRLNDGHVASLGLLARKDGTRKGYLSKRSSDNTKWQTKWFALLQNLLFYFESDSSSRPSGLYLLEG
CVCDRAPSPKPALSAKEPLEKQHYFTVNFSHENQKALELRTEDAKDCDEWVAAIAHASYRTLATEHEALM
QKYLHLLQIVETEKTVAKQLRQQIEDGEIEIERLKAEITSLLKDNERIQSTQTVAPNDEDSDIKKIKKVQ
SFLRGWLCRRKWKTIIQDYIRSPHADSMRKRNQVVFSMLEAEAEYVQQLHILVNNFLRPLRMAASSKKPP
ITHDDVSSIFLNSETIMFLHQIFYQGLKARISSWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQILAHC
KQNRDFDKLLKHYEAKPDCEERTLETFLTYPMFQIPRYILTLHELLAHTPHEHVERNSLDYAKSKLEELS
RIMHDEVSETENIRKNLAIERMIIEGCEILLDTSQTFVRQGSLIQVPMSEKGKITRGRLGSLSLKKEGER
QCFLFSKHLIICTRGSGGKLHLTKNGVISLIDCTLLEEPESTEEEAKGSGQDIDHLDFKIGVEPKDSPPF
TVILVASSRQEKAAWTSDISQCVDNIRCNGLMMNAFEENSKVTVPQMIKRTREGTREAEMSRSDASLYCD
DVDIRFSKTMNSCKVLQIRYASVERLLERLTDLRFLSIDFLNTFLHSYRVFTTAIVVLDKLITIYKKPIS
AIPARWLRSLELLFASGQNNKLLYGEPPKSPRATRKFSSPPPLSITKTSSPSRRRKLSLNIPIITGGKAL
DLAALSCNSNGYTSMYSAMSPFSKATLDTSKLYVSSSFTNKIPDEGDTTPEKPEDPSALSKQSSEVSMRE
ESDIDQNQSDDGDTETSPTKSPTTPKSVKNKNSSEFPLFSYNNGVVMTSCRELDNNRSALSAASAFAIAT
AGANEGTPNKEKYRRMSLASAGFPPDQRNGDKEFVIRRAATNRVLNVLRHWVSKHSQDFETNDELKCKVI
GFLEEVMHDPELLTQERKAAANIIRTLTQEDPGDNQITLEEITQMAEGVKAEPFENHSALEIAEQLTLLD
HLVFKKIPYEEFFGQGWMKLEKNERTPYIMKTTKHFNDISNLIASEIIRNEDINARVSAIEKWVAVADIC
RCLHNYNAVLEITSSMNRSAIFRLKKTWLKVSKQTKALIDKLQKLVSSEGRFKNLREALKNCDPPCVPYL
GMYLTDLAFIEEGTPNYTEDGLVNFSKMRMISHIIREIRQFQQTAYKIEHQAKVTQYLLDQSFVMDEESL
YESSLRIEPKLPT

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_002891
ORF Size 3819 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_002891.6
RefSeq Size 4022 bp
RefSeq ORF 3822 bp
Locus ID 5923
UniProt ID Q13972
Cytogenetics 15q25.1
Domains IQ, RhoGEF, RasGEFN, PH, RasGEF
Protein Families Druggable Genome
Protein Pathways Focal adhesion, MAPK signaling pathway
MW 145.1 kDa
Gene Summary The protein encoded by this gene is a guanine nucleotide exchange factor (GEF) similar to the Saccharomyces cerevisiae CDC25 gene product. Functional analysis has demonstrated that this protein stimulates the dissociation of GDP from RAS protein. The studies of the similar gene in mouse suggested that the Ras-GEF activity of this protein in brain can be activated by Ca2+ influx, muscarinic receptors, and G protein beta-gamma subunit. Mouse studies also indicated that the Ras-GEF signaling pathway mediated by this protein may be important for long-term memory. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Mar 2009]

Other Versions

Other products for "RASGRF1"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


Rabbit polyclonal Anti-RASGRF1 Antibody
    • 100 ul

USD 475.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.