PDZD6 (INTU) (NM_015693) Human Tagged ORF Clone

CAT#: RC218556

Reviews ()
Write a review

INTU (Myc-DDK-tagged)-Human inturned planar cell polarity effector homolog (Drosophila) (INTU)



  "NM_015693" in other vectors (6)

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 851.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol INTU
Synonyms CPLANE4; INT; OFD17; PDZD6; PDZK6; SRTD20
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC218556 representing NM_015693
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCTCTGTGGCTTCGTGCGATTCGCGTCCGAGCTCAGACGAGCTCCCTGGAGACCCCTCTTCACAAG
AAGAAGATGAGGACTATGATTTTGAAGATCGGGTCAGCGACTCGGGTTCATATTCCTCAGCGAGTAGCGA
TTATGATGATCTTGAGCCTGAATGGCTGGACAGTGTGCAGAAAAATGGAGAGCTGTTTTATTTGGAATTG
AGTGAGGATGAAGAAGAAAGCCTCCTTCCTGAGACACCAACTGTGAACCATGTCAGGTTCAGTGAAAATG
AGATTATCATTGAAGATGACTACAAAGAAAGAAAAAAGTATGAACCCAAACTCAAGCAGTTTACCAAAAT
TTTAAGAAGGAAAAGACTTTTACCCAAGCGCTGCAATAAAAAAAATAGCAATGACAATGGACCAGTATCC
ATTCTAAAGCATCAGTCCAATCAGAAGACAGGAGTCATTGTCCAACAGCGATACAAAGATGTGAATGTTT
ATGTAAACCCCAAAAAGCTAACTGTTATCAAAGCCAAAGAGCAGCTCAAGCTTCTGGAAGTGCTGGTTGG
AATTATTCATCAGACCAAGTGGAGCTGGAGAAGAACCGGAAAGCAGGGTGATGGAGAGAGGCTTGTGGTT
CATGGCCTGCTGCCAGGGGGATCTGCTATGAAGAGCGGTCAGGTACTCATTGGTGATGTCCTTGTTGCTG
TGAATGATGTCGATGTTACTACTGAAAACATCGAGAGAGTTCTGTCTTGCATTCCTGGACCTATGCAGGT
GAAACTGACATTTGAAAATGCATATGATGTGAAAAGGGAGACGTCCCATCCAAGACAGAAAAAGACACAG
TCCAACACAAGTGATTTAGTCAAGCTTCTCTGGGGAGAAGAGGTTGAAGGTATCCAGCAGAGTGGCCTAA
ACACTCCTCATATCATTATGTATCTCACACTACAGCTCGACTCAGAAACCTCAAAGGAAGAGCAGGAAAT
TCTTTATCATTATCCAATGTCTGAAGCATCTCAGAAACTTAAAAGTGTGAGAGGGATTTTTCTCACACTC
TGTGACATGCTGGAAAACGTAACTGGGACACAAGTTACTAGTTCATCCCTCCTTTTAAATGGAAAACAAA
TTCATGTGGCTTATTGGAAAGAATCTGACAAGTTGTTGCTAATTGGCCTGCCTGCTGAAGAAGTTCCTCT
TCCTCGTCTAAGGAACATGATAGAAAATGTCATCCAAACCTTAAAATTTATGTATGGTTCTTTAGATAGT
GCCTTTTGCCAGATTGAGAATGTTCCTCGTTTGGATCATTTTTTTAACTTGTTCTTTCAAAGAGCACTTC
AGCCTGCGAAACTGCATTCCAGCGCCAGTCCCAGTGCTCAGCAGTACGATGCTTCCAGTGCAGTACTTTT
AGACAACCTCCCTGGAGTCCGGTGGCTCACACTTCCACTGGAAATCAAGATGGAATTAGACATGGCATTA
AGTGACTTGGAGGCTGCAGATTTTGCAGAACTGTCCGAGGATTACTATGACATGAGGCGGCTGTATACAA
TTTTGGGGTCTTCTCTATTTTACAAGGGTTATTTGATATGCAGTCATTTGCCCAAGGATGATCTTATTGA
TATTGCCGTATACTGTCGCCACTATTGCCTGCTGCCTTTAGCAGCAAAACAAAGAATTGGTCAGTTGATC
ATATGGAGAGAAGTGTTTCCTCAGCATCACCTCCGACCTTTGGCAGACTCAAGCACTGAAGTCTTTCCGG
AACCTGAAGGAAGATATTTTTTGCTAGTTGTTGGCTTGAAACATTATATGCTATGTGTACTATTAGAAGC
TGGAGGTTGCGCATCCAAAGCTATTGGGAGTCCTGGACCAGACTGTGTATATGTGGATCAAGTCAAAACA
ACTCTTCACCAGCTGGATGGAGTAGATTCTCGCATAGATGAACGGCTAGCATCTTCTCCAGTCCCCTGTT
TGTCTTGTGCTGACTGGTTCCTTACTGGATCACGTGAAAAAACAGATAGCTTGACCACTTCGCCTATTCT
CAGTAGGCTACAAGGTACTTCCAAAGTAGCAACTTCTCCAACATGCAGAAGAACGCTTTTTGGTGACTAT
TCCTTAAAGACACGCAAGCCTAGTCCTTCCTGTAGTAGTGGAGGATCTGACAATGGTTGTGAAGGTGGAG
AAGATGATGGCTTTAGCCCCCATACTACACCGGATGCAGTACGGAAGCAAAGAGAATCTCAGGGCTCTGA
TGGTTTAGAAGAAAGTGGGACCTTGCTTAAGGTCACTAAAAAGAAGTCTACTCTTCCAAATCCATTTCAT
TTGGGAAACTTGAAAAAGGACCTTCCAGAAAAAGAATTAGAAATATATAACACAGTGAAACTGACATCTG
GTCCTGAGAACACACTTTTCCACTACGTTGCCTTAGAAACAGTGCAAGGAATCTTTATTACTCCTACCCT
TGAAGAGGTGGCACAGCTAAGTGGCTCTATCCACCCTCAGCTAATAAAGAATTTCCATCAGTGTTGTCTT
TCCATTCGTGCAGTTTTCCAACAGACATTGGTGGAAGAGAAAAAGAAAGGACTAAATAGTGGAGACCATT
CAGATTCTGCAAAGTCAGTGTCTTCTCTTAACCCTGTTAAAGAACATGGTGTGTTGTTTGAATGTTCACC
TGGAAACTGGACTGATCAGAAAAAAGCACCACCAGTTATGGCTTACTGGGTAGTAGGGAGACTTTTTCTT
CATCCAAAACCTCAAGAACTTTATGTCTGTTTTCATGACTCAGTCACAGAAATTGCCATTGAAATAGCTT
TTAAATTGTTCTTTGGGTTAACCTTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC218556 representing NM_015693
Red=Cloning site Green=Tags(s)

MASVASCDSRPSSDELPGDPSSQEEDEDYDFEDRVSDSGSYSSASSDYDDLEPEWLDSVQKNGELFYLEL
SEDEEESLLPETPTVNHVRFSENEIIIEDDYKERKKYEPKLKQFTKILRRKRLLPKRCNKKNSNDNGPVS
ILKHQSNQKTGVIVQQRYKDVNVYVNPKKLTVIKAKEQLKLLEVLVGIIHQTKWSWRRTGKQGDGERLVV
HGLLPGGSAMKSGQVLIGDVLVAVNDVDVTTENIERVLSCIPGPMQVKLTFENAYDVKRETSHPRQKKTQ
SNTSDLVKLLWGEEVEGIQQSGLNTPHIIMYLTLQLDSETSKEEQEILYHYPMSEASQKLKSVRGIFLTL
CDMLENVTGTQVTSSSLLLNGKQIHVAYWKESDKLLLIGLPAEEVPLPRLRNMIENVIQTLKFMYGSLDS
AFCQIENVPRLDHFFNLFFQRALQPAKLHSSASPSAQQYDASSAVLLDNLPGVRWLTLPLEIKMELDMAL
SDLEAADFAELSEDYYDMRRLYTILGSSLFYKGYLICSHLPKDDLIDIAVYCRHYCLLPLAAKQRIGQLI
IWREVFPQHHLRPLADSSTEVFPEPEGRYFLLVVGLKHYMLCVLLEAGGCASKAIGSPGPDCVYVDQVKT
TLHQLDGVDSRIDERLASSPVPCLSCADWFLTGSREKTDSLTTSPILSRLQGTSKVATSPTCRRTLFGDY
SLKTRKPSPSCSSGGSDNGCEGGEDDGFSPHTTPDAVRKQRESQGSDGLEESGTLLKVTKKKSTLPNPFH
LGNLKKDLPEKELEIYNTVKLTSGPENTLFHYVALETVQGIFITPTLEEVAQLSGSIHPQLIKNFHQCCL
SIRAVFQQTLVEEKKKGLNSGDHSDSAKSVSSLNPVKEHGVLFECSPGNWTDQKKAPPVMAYWVVGRLFL
HPKPQELYVCFHDSVTEIAIEIAFKLFFGLTL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_015693
ORF Size 2826 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_015693.4
RefSeq Size 3238 bp
RefSeq ORF 2829 bp
Locus ID 27152
UniProt ID Q9ULD6
Cytogenetics 4q28.1
MW 105.5 kDa
Gene Summary Plays a key role in ciliogenesis and embryonic development. Regulator of cilia formation by controlling the organization of the apical actin cytoskeleton and the positioning of the basal bodies at the apical cell surface, which in turn is essential for the normal orientation of elongating ciliary microtubules. Plays a key role in definition of cell polarity via its role in ciliogenesis but not via conversion extension. Has an indirect effect on hedgehog signaling (By similarity). Proposed to function as core component of the CPLANE (ciliogenesis and planar polarity effectors) complex involved in the recruitment of peripheral IFT-A proteins to basal bodies (PubMed:27158779).[UniProtKB/Swiss-Prot Function]

Other Versions

Other products for "INTU"
Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.