CAMLG (NM_001745) Human Tagged ORF Clone

CAT#: RC218292

CAMLG (Myc-DDK-tagged)-Human calcium modulating ligand (CAMLG)

Product Images

Circular map for RC218292

• 

  HEK293T cells were transfected with the pCMV6-ENTRY control (Cat# PS100001, Left lane) or pCMV6-ENTRY CAMLG (Cat# RC218292, Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-CAMLG (Cat# TA504329). Positive lysates LY419768 (100ug) and LC419768 (20ug) can be purchased separately from OriGene.

• 

  Western blot validation of overexpression lysate (Cat# LY419768) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC218292 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified CAMLG protein (Cat# TP318292). The protein was produced from HEK293T cells transfected with CAMLG cDNA clone (Cat# RC218292) using MegaTran 2.0 (Cat# TT210002).

• 

  Anti-CAMLG mouse monoclonal antibody (TA504329) immunofluorescent staining of COS7 cells transiently transfected by pCMV6-ENTRY CAMLG (RC218292).

• 

  HEK293T cells transfected with either RC218292 overexpress plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-CAMLG antibody (TA504329), and then analyzed by flow cytometry.

Show all 6 images

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: CAMLG
• Synonyms: CAML; GET2
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC218292 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGAGTCGATGGCCGTCGCTACCGACGGCGGGGAGAGGCCGGGGGTCCCAGCGGGCTCAGGTCTGTCGG
  CTTCCCAGCGTCGGGCGGAGCTGCGTCGGAGAAAGCTGCTCATGAACTCGGAACAGCGCATCAACCGGAT
  CATGGGCTTTCACAGGCCCGGGAGCGGCGCGGAAGAAGAAAGTCAAACAAAATCAAAGCAGCAGGACAGT
  GATAAACTGAACTCCCTCAGCGTTCCTTCCGTTTCAAAGCGAGTAGTGCTGGGTGATTCAGTCAGTACAG
  GAACAACTGACCAGCAGGGTGGTGTGGCCGAGGTAAAGGGGACCCAACTGGGAGACAAATTGGACTCGTT
  CATTAAACCACCTGAGTGCAGTAGTGATGTCAACCTTGAGCTCCGGCAGCGGAACAGAGGGGACCTGACA
  GCGGACTCGGTCCAGAGGGGTTCCCGCCATGGCCTAGAGCAGTACCTTTCCAGATTCGAAGAAGCAATGA
  AGCTAAGGAAACAGCTGATTAGTGAAAAACCCAGTCAAGAGGATGGAAATACAACAGAAGAATTTGACTC
  TTTTCGAATATTTAGATTGGTGGGATGTGCTCTTCTTGCTCTTGGAGTCAGAGCTTTTGTTTGCAAATAC
  TTGTCCATATTTGCTCCATTTCTTACTTTACAACTTGCGTACATGGGATTATACAAATATTTTCCCAAGA
  GTGAAAAGAAGATAAAGACAACAGTACTAACAGCTGCACTTCTATTGTCGGGAATTCCTGCCGAAGTGAT
  AAATCGATCAATGGATACCTATAGCAAAATGGGCGAAGTCTTCACAGATCTCTGTGTCTACTTTTTCACT
  TTTATCTTTTGTCATGAACTGCTTGATTATTGGGGCTCTGAAGTACCA
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC218292 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MESMAVATDGGERPGVPAGSGLSASQRRAELRRRKLLMNSEQRINRIMGFHRPGSGAEEESQTKSKQQDS
  DKLNSLSVPSVSKRVVLGDSVSTGTTDQQGGVAEVKGTQLGDKLDSFIKPPECSSDVNLELRQRNRGDLT
  ADSVQRGSRHGLEQYLSRFEEAMKLRKQLISEKPSQEDGNTTEEFDSFRIFRLVGCALLALGVRAFVCKY
  LSIFAPFLTLQLAYMGLYKYFPKSEKKIKTTVLTAALLLSGIPAEVINRSMDTYSKMGEVFTDLCVYFFT
  FIFCHELLDYWGSEVP
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001745
• ORF Size: 888 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_001745.4
• RefSeq Size: 2255 bp
• RefSeq ORF: 891 bp
• Locus ID: 819
• UniProt ID: P49069
• Cytogenetics: 5q31.1
• Protein Families: Druggable Genome
• MW: 33 kDa
• Gene Summary: The immunosuppressant drug cyclosporin A blocks a calcium-dependent signal from the T-cell receptor (TCR) that normally leads to T-cell activation. When bound to cyclophilin B, cyclosporin A binds and inactivates the key signaling intermediate calcineurin. The protein encoded by this gene functions similarly to cyclosporin A, binding to cyclophilin B and acting downstream of the TCR and upstream of calcineurin by causing an influx of calcium. This integral membrane protein appears to be a new participant in the calcium signal transduction pathway, implicating cyclophilin B in calcium signaling, even in the absence of cyclosporin. [provided by RefSeq, Jul 2008]