G0 Protein alpha(GNAO1) (NM_020988) Human Tagged ORF Clone

CAT#: RC217958

GNAO1 (Myc-DDK-tagged)-Human guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O (GNAO1), transcript variant 1

Clone Modification / Custom Cloning Service

USD 443.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name G0 Protein alpha(GNAO1) (NM_020988) Human Tagged ORF Clone
Symbol GNAO1
Synonyms EIEE17; G-ALPHA-o; GNAO; HLA-DQB1
Vector pCMV6-Entry
Sequence Data
>RC217958 representing NM_020988
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGATGTACTCTGAGCGCAGAGGAGAGAGCCGCCCTCGAGCGGAGCAAGGCGATTGAGAAAAACCTCA
AAGAGGATGGCATCAGCGCCGCCAAAGACGTGAAATTACTCCTGCTCGGGGCTGGAGAATCAGGAAAAAG
CACCATTGTGAAGCAGATGAAGATCATCCATGAAGATGGCTTCTCCGGAGAAGACGTGAAACAGTACAAG
CCTGTTGTCTACAGCAACACTATCCAGTCCCTGGCAGCCATCGTCCGGGCCATGGACACTTTGGGCATCG
AATATGGTGATAAGGAGAGAAAGGCTGACGCCAAGATGGTGTGTGATGTGGTGAGTCGGATGGAAGACAC
CGAGCCCTTCTCTGCAGAGCTGCTTTCTGCCATGATGCGGCTCTGGGGCGACTCAGGAATCCAAGAGTGC
TTCAACCGGTCCCGGGAGTATCAACTCAACGACTCTGCCAAATACTACCTGGACAGCCTGGATCGGATTG
GGGCCGCCGACTACCAGCCCACTGAGCAGGACATCCTCCGAACCAGGGTCAAAACCACTGGCATCGTAGA
AACCCACTTCACATTCAAGAACCTCCACTTCAGGCTGTTTGACGTCGGAGGCCAGCGATCTGAACGCAAG
AAGTGGATCCATTGCTTCGAGGACGTCACGGCCATCATTTTCTGTGTCGCGCTCAGCGGCTATGACCAGG
TGCTCCACGAAGACGAAACCACGAACCGCATGCACGAGTCTCTCATGCTCTTCGACTCCATCTGTAACAA
CAAGTTCTTCATCGATACCTCCATCATTCTCTTCCTCAACAAGAAAGATCTCTTTGGCGAGAAGATCAAG
AAGTCACCTTTGACCATCTGCTTTCCTGAATACACAGGCCCCAATACCTATGAAGACGCAGCCGCCTACA
TCCAAGCACAATTTGAAAGCAAAAACCGCTCACCCAACAAAGAAATATATTGTCACATGACTTGTGCCAC
AGACACGAATAACATCCAGGTGGTGTTCGACGCCGTCACCGACATCATCATTGCCAACAACCTCCGGGGC
TGCGGCTTGTAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC217958 representing NM_020988
Red=Cloning site Green=Tags(s)

MGCTLSAEERAALERSKAIEKNLKEDGISAAKDVKLLLLGAGESGKSTIVKQMKIIHEDGFSGEDVKQYK
PVVYSNTIQSLAAIVRAMDTLGIEYGDKERKADAKMVCDVVSRMEDTEPFSAELLSAMMRLWGDSGIQEC
FNRSREYQLNDSAKYYLDSLDRIGAADYQPTEQDILRTRVKTTGIVETHFTFKNLHFRLFDVGGQRSERK
KWIHCFEDVTAIIFCVALSGYDQVLHEDETTNRMHESLMLFDSICNNKFFIDTSIILFLNKKDLFGEKIK
KSPLTICFPEYTGPNTYEDAAAYIQAQFESKNRSPNKEIYCHMTCATDTNNIQVVFDAVTDIIIANNLRG
CGLY

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_020988
ORF Size 1062 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_020988.1, NM_020988.2, NP_066268
RefSeq Size 3332
RefSeq ORF 1065
Locus ID 2775
Cytogenetics 16q13
Domains G-alpha
Protein Families Druggable Genome
Protein Pathways Long-term depression, Melanogenesis
MW 40.1 kDa
Gene Summary The protein encoded by this gene represents the alpha subunit of the Go heterotrimeric G-protein signal-transducing complex. Defects in this gene are a cause of early-onset epileptic encephalopathy. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2015].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)