Chloride Channel 5(CLCN5) (NM_000084) Human Tagged ORF Clone

CAT#: RC217750

CLCN5 (Myc-DDK-tagged)-Human chloride channel 5 (CLCN5), transcript variant 3

Change vector?

USD 577


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Chloride Channel 5(CLCN5) (NM_000084) Human Tagged ORF Clone
Symbol CLCN5
Synonyms ClC-5; CLC5; CLCK2; DENTS; hCIC-K2; NPHL1; NPHL2; XLRH; XRN
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC217750 representing NM_000084
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACTTCTTGGAGGAGCCAATCCCTGGTGTAGGGACCTATGATGATTTCAATACAATTGATTGGGTGA
GAGAGAAGTCTCGAGACCGGGATAGGCACCGAGAGATTACCAATAAAAGCAAAGAGTCAACATGGGCCTT
AATTCACAGTGTGAGTGATGCTTTTTCCGGCTGGTTGTTGATGCTCCTTATTGGGCTTTTATCAGGTTCG
TTAGCTGGTTTGATAGACATCTCTGCTCATTGGATGACAGACTTAAAAGAAGGTATATGCACAGGGGGAT
TCTGGTTTAACCATGAACATTGTTGCTGGAACTCTGAGCATGTCACCTTTGAAGAGAGAGACAAATGTCC
AGAGTGGAATAGTTGGTCCCAGCTTATCATCAGCACAGATGAGGGAGCCTTTGCCTACATAGTCAATTAT
TTCATGTACGTCCTCTGGGCTCTCCTATTTGCCTTCCTTGCCGTATCTCTTGTCAAGGTGTTTGCGCCTT
ATGCCTGTGGCTCTGGAATCCCTGAGATAAAAACTATCTTGAGTGGTTTCATTATTAGGGGCTATTTGGG
TAAGTGGACTCTGGTTATCAAAACCATCACCTTGGTGCTGGCAGTGTCGTCTGGCTTGAGCCTGGGCAAA
GAGGGCCCTCTAGTGCACGTGGCTTGCTGCTGTGGGAACATCCTGTGCCACTGCTTCAACAAATACAGGA
AGAATGAAGCCAAGCGCAGAGAGGTCTTGTCGGCTGCAGCAGCAGCTGGTGTATCTGTAGCCTTTGGAGC
ACCTATAGGTGGAGTATTATTCAGCCTTGAAGAGGTCAGCTACTATTTTCCCCTCAAAACATTGTGGCGT
TCATTCTTTGCTGCCTTGGTGGCAGCATTCACTCTACGCTCCATCAATCCATTTGGGAACAGCCGCCTGG
TACTATTTTATGTGGAGTTTCACACCCCATGGCATCTCTTTGAGCTCGTGCCATTCATTCTGCTGGGCAT
ATTTGGTGGTCTGTGGGGAGCACTGTTTATCCGCACAAACATTGCCTGGTGTCGGAAGCGAAAGACCACC
CAGTTGGGCAAGTATCCTGTTATAGAGGTACTCGTCGTGACAGCCATCACTGCCATCCTGGCTTTCCCCA
ATGAATACACTCGGATGAGCACAAGTGAGCTCATTTCTGAGCTGTTTAATGACTGTGGCCTTCTGGACTC
CTCCAAGCTCTGTGATTATGAGAACCGTTTCAACACAAGCAAAGGGGGTGAACTGCCTGACAGACCGGCT
GGCGTGGGAGTCTACAGTGCAATGTGGCAGCTGGCTTTAACACTCATACTGAAAATTGTCATTACTATAT
TCACCTTTGGCATGAAGATCCCTTCTGGCCTCTTTATCCCTAGCATGGCTGTTGGTGCTATAGCAGGTCG
ACTTCTAGGAGTAGGAATGGAACAGCTGGCTTATTACCACCAGGAATGGACCGTCTTCAATAGCTGGTGT
AGTCAGGGAGCTGATTGCATCACCCCCGGCCTTTATGCAATGGTTGGGGCTGCAGCCTGCTTAGGTGGGG
TGACTCGGATGACTGTTTCTCTTGTTGTCATAATGTTTGAACTGACTGGTGGCTTAGAATACATCGTGCC
TCTGATGGCTGCAGCCATGACAAGCAAGTGGGTGGCAGATGCTCTTGGGCGGGAGGGCATCTATGATGCC
CACATCCGTCTCAATGGATACCCCTTTCTTGAAGCCAAAGAAGAGTTTGCTCATAAGACCCTGGCAATGG
ATGTGATGAAACCCCGGAGAAATGATCCTTTGTTGACTGTCCTTACTCAGGACAGTATGACTGTGGAAGA
TGTAGAGACCATAATCAGTGAAACCACTTACAGTGGCTTCCCAGTGGTGGTATCCCGGGAGTCCCAAAGA
CTTGTGGGCTTTGTCCTCCGAAGAGATCTCATTATTTCAATTGAAAATGCTCGAAAGAAACAGGATGGGG
TTGTTAGCACTTCCATCATTTATTTCACGGAGCATTCTCCTCCATTGCCACCATACACTCCACCCACTCT
AAAGCTTCGGAACATCCTCGATCTCAGCCCCTTCACTGTGACTGACCTTACACCCATGGAGATCGTAGTG
GATATTTTCCGAAAGCTGGGACTGCGGCAGTGCCTGGTTACACACAACGGGCGATTGCTTGGAATCATTA
CCAAAAAGGATGTGTTAAAGCATATAGCACAGATGGCGAACCAAGATCCTGATTCCATTCTCTTCAAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC217750 representing NM_000084
Red=Cloning site Green=Tags(s)

MDIPATAMDFSMRDDVPPLDREVGEDKSYNGGGIGSSNRIMDFLEEPIPGVGTYDDFNTIDWVREKSRDR
DRHREITNKSKESTWALIHSVSDAFSGWLLMLLIGLLSGSLAGLIDISAHWMTDLKEGICTGGFWFNHEH
CCWNSEHVTFEERDKCPEWNSWSQLIISTDEGAFAYIVNYFMYVLWALLFAFLAVSLVKVFAPYACGSGI
PEIKTILSGFIIRGYLGKWTLVIKTITLVLAVSSGLSLGKEGPLVHVACCCGNILCHCFNKYRKNEAKRR
EVLSAAAAAGVSVAFGAPIGGVLFSLEEVSYYFPLKTLWRSFFAALVAAFTLRSINPFGNSRLVLFYVEF
HTPWHLFELVPFILLGIFGGLWGALFIRTNIAWCRKRKTTQLGKYPVIEVLVVTAITAILAFPNEYTRMS
TSELISELFNDCGLLDSSKLCDYENRFNTSKGGELPDRPAGVGVYSAMWQLALTLILKIVITIFTFGMKI
PSGLFIPSMAVGAIAGRLLGVGMEQLAYYHQEWTVFNSWCSQGADCITPGLYAMVGAAACLGGVTRMTVS
LVVIMFELTGGLEYIVPLMAAAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEFAHKTLAMDVMKPRR
NDPLLTVLTQDSMTVEDVETIISETTYSGFPVVVSRESQRLVGFVLRRDLIISIENARKKQDGVVSTSII
YFTEHSPPLPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLVTHNGRLLGIITKKDVLK
HIAQMANQDPDSILFN

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_000084
ORF Size 2238 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_000084.1, NM_000084.2, NM_000084.3, NM_000084.4, NP_000075
RefSeq Size 3173
RefSeq ORF 2241
Locus ID 1184
Cytogenetics Xp11.23
Domains CBS, voltage_CLC
Protein Families Ion Channels: Other, Transmembrane, Druggable Genome
MW 83 kDa
Gene Summary This gene encodes a member of the ClC family of chloride ion channels and ion transporters. The encoded protein is primarily localized to endosomal membranes and may function to facilitate albumin uptake by the renal proximal tubule. Mutations in this gene have been found in Dent disease and renal tubular disorders complicated by nephrolithiasis. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jan 2013].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations