Chloride Channel 5 (CLCN5) (NM_000084) Human Tagged ORF Clone

CAT#: RC217750

Reviews ()
Write a review

CLCN5 (Myc-DDK-tagged)-Human chloride channel 5 (CLCN5), transcript variant 3



  "NM_000084" in other vectors (6)

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 477.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol CLCN5
Synonyms ClC-5; CLC5; CLCK2; DENT1; DENTS; hCIC-K2; NPHL1; NPHL2; XLRH; XRN
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC217750 representing NM_000084
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACTTCTTGGAGGAGCCAATCCCTGGTGTAGGGACCTATGATGATTTCAATACAATTGATTGGGTGA
GAGAGAAGTCTCGAGACCGGGATAGGCACCGAGAGATTACCAATAAAAGCAAAGAGTCAACATGGGCCTT
AATTCACAGTGTGAGTGATGCTTTTTCCGGCTGGTTGTTGATGCTCCTTATTGGGCTTTTATCAGGTTCG
TTAGCTGGTTTGATAGACATCTCTGCTCATTGGATGACAGACTTAAAAGAAGGTATATGCACAGGGGGAT
TCTGGTTTAACCATGAACATTGTTGCTGGAACTCTGAGCATGTCACCTTTGAAGAGAGAGACAAATGTCC
AGAGTGGAATAGTTGGTCCCAGCTTATCATCAGCACAGATGAGGGAGCCTTTGCCTACATAGTCAATTAT
TTCATGTACGTCCTCTGGGCTCTCCTATTTGCCTTCCTTGCCGTATCTCTTGTCAAGGTGTTTGCGCCTT
ATGCCTGTGGCTCTGGAATCCCTGAGATAAAAACTATCTTGAGTGGTTTCATTATTAGGGGCTATTTGGG
TAAGTGGACTCTGGTTATCAAAACCATCACCTTGGTGCTGGCAGTGTCGTCTGGCTTGAGCCTGGGCAAA
GAGGGCCCTCTAGTGCACGTGGCTTGCTGCTGTGGGAACATCCTGTGCCACTGCTTCAACAAATACAGGA
AGAATGAAGCCAAGCGCAGAGAGGTCTTGTCGGCTGCAGCAGCAGCTGGTGTATCTGTAGCCTTTGGAGC
ACCTATAGGTGGAGTATTATTCAGCCTTGAAGAGGTCAGCTACTATTTTCCCCTCAAAACATTGTGGCGT
TCATTCTTTGCTGCCTTGGTGGCAGCATTCACTCTACGCTCCATCAATCCATTTGGGAACAGCCGCCTGG
TACTATTTTATGTGGAGTTTCACACCCCATGGCATCTCTTTGAGCTCGTGCCATTCATTCTGCTGGGCAT
ATTTGGTGGTCTGTGGGGAGCACTGTTTATCCGCACAAACATTGCCTGGTGTCGGAAGCGAAAGACCACC
CAGTTGGGCAAGTATCCTGTTATAGAGGTACTCGTCGTGACAGCCATCACTGCCATCCTGGCTTTCCCCA
ATGAATACACTCGGATGAGCACAAGTGAGCTCATTTCTGAGCTGTTTAATGACTGTGGCCTTCTGGACTC
CTCCAAGCTCTGTGATTATGAGAACCGTTTCAACACAAGCAAAGGGGGTGAACTGCCTGACAGACCGGCT
GGCGTGGGAGTCTACAGTGCAATGTGGCAGCTGGCTTTAACACTCATACTGAAAATTGTCATTACTATAT
TCACCTTTGGCATGAAGATCCCTTCTGGCCTCTTTATCCCTAGCATGGCTGTTGGTGCTATAGCAGGTCG
ACTTCTAGGAGTAGGAATGGAACAGCTGGCTTATTACCACCAGGAATGGACCGTCTTCAATAGCTGGTGT
AGTCAGGGAGCTGATTGCATCACCCCCGGCCTTTATGCAATGGTTGGGGCTGCAGCCTGCTTAGGTGGGG
TGACTCGGATGACTGTTTCTCTTGTTGTCATAATGTTTGAACTGACTGGTGGCTTAGAATACATCGTGCC
TCTGATGGCTGCAGCCATGACAAGCAAGTGGGTGGCAGATGCTCTTGGGCGGGAGGGCATCTATGATGCC
CACATCCGTCTCAATGGATACCCCTTTCTTGAAGCCAAAGAAGAGTTTGCTCATAAGACCCTGGCAATGG
ATGTGATGAAACCCCGGAGAAATGATCCTTTGTTGACTGTCCTTACTCAGGACAGTATGACTGTGGAAGA
TGTAGAGACCATAATCAGTGAAACCACTTACAGTGGCTTCCCAGTGGTGGTATCCCGGGAGTCCCAAAGA
CTTGTGGGCTTTGTCCTCCGAAGAGATCTCATTATTTCAATTGAAAATGCTCGAAAGAAACAGGATGGGG
TTGTTAGCACTTCCATCATTTATTTCACGGAGCATTCTCCTCCATTGCCACCATACACTCCACCCACTCT
AAAGCTTCGGAACATCCTCGATCTCAGCCCCTTCACTGTGACTGACCTTACACCCATGGAGATCGTAGTG
GATATTTTCCGAAAGCTGGGACTGCGGCAGTGCCTGGTTACACACAACGGGCGATTGCTTGGAATCATTA
CCAAAAAGGATGTGTTAAAGCATATAGCACAGATGGCGAACCAAGATCCTGATTCCATTCTCTTCAAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC217750 representing NM_000084
Red=Cloning site Green=Tags(s)

MDIPATAMDFSMRDDVPPLDREVGEDKSYNGGGIGSSNRIMDFLEEPIPGVGTYDDFNTIDWVREKSRDR
DRHREITNKSKESTWALIHSVSDAFSGWLLMLLIGLLSGSLAGLIDISAHWMTDLKEGICTGGFWFNHEH
CCWNSEHVTFEERDKCPEWNSWSQLIISTDEGAFAYIVNYFMYVLWALLFAFLAVSLVKVFAPYACGSGI
PEIKTILSGFIIRGYLGKWTLVIKTITLVLAVSSGLSLGKEGPLVHVACCCGNILCHCFNKYRKNEAKRR
EVLSAAAAAGVSVAFGAPIGGVLFSLEEVSYYFPLKTLWRSFFAALVAAFTLRSINPFGNSRLVLFYVEF
HTPWHLFELVPFILLGIFGGLWGALFIRTNIAWCRKRKTTQLGKYPVIEVLVVTAITAILAFPNEYTRMS
TSELISELFNDCGLLDSSKLCDYENRFNTSKGGELPDRPAGVGVYSAMWQLALTLILKIVITIFTFGMKI
PSGLFIPSMAVGAIAGRLLGVGMEQLAYYHQEWTVFNSWCSQGADCITPGLYAMVGAAACLGGVTRMTVS
LVVIMFELTGGLEYIVPLMAAAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEFAHKTLAMDVMKPRR
NDPLLTVLTQDSMTVEDVETIISETTYSGFPVVVSRESQRLVGFVLRRDLIISIENARKKQDGVVSTSII
YFTEHSPPLPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLVTHNGRLLGIITKKDVLK
HIAQMANQDPDSILFN

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_000084
ORF Size 2238 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_000084.3
RefSeq Size 3173 bp
RefSeq ORF 2241 bp
Locus ID 1184
UniProt ID P51795
Cytogenetics Xp11.23
Domains CBS, voltage_CLC
Protein Families Druggable Genome, Ion Channels: Other, Transmembrane
MW 83 kDa
Gene Summary This gene encodes a member of the ClC family of chloride ion channels and ion transporters. The encoded protein is primarily localized to endosomal membranes and may function to facilitate albumin uptake by the renal proximal tubule. Mutations in this gene have been found in Dent disease and renal tubular disorders complicated by nephrolithiasis. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jan 2013]

Other Versions

Other products for "CLCN5"
Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.