TRIF (TICAM1) (NM_182919) Human Tagged ORF Clone

CAT#: RC217522

Reviews ()
Write a review

TICAM1 (Myc-DDK-tagged)-Human toll-like receptor adaptor molecule 1 (TICAM1)



  "NM_182919" in other vectors (4)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 691.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol TICAM1
Synonyms IIAE6; MyD88-3; PRVTIRB; TICAM-1; TRIF
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC217522 representing NM_182919
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCTGCACAGGCCCATCACTTCCTAGCGCCTTCGACATTCTAGGTGCAGCAGGCCAGGACAAGCTCT
TGTATCTGAAGCACAAACTGAAGACCCCACGCCCAGGCTGCCAGGGGCAGGACCTCCTGCATGCCATGGT
TCTCCTGAAGCTGGGCCAGGAAACTGAGGCCAGGATCTCTCTAGAGGCATTGAAGGCCGATGCGGTGGCC
CGGCTGGTGGCCCGCCAGTGGGCTGGCGTGGACAGCACCGAGGACCCAGAGGAGCCCCCAGATGTGTCCT
GGGCTGTGGCCCGCTTGTACCACCTGCTGGCTGAGGAGAAGCTGTGCCCCGCCTCGCTGCGGGACGTGGC
CTACCAGGAAGCCGTCCGCACCCTCAGCTCCAGGGACGACCACCGGCTGGGGGAACTTCAGGATGAGGCC
CGAAACCGGTGTGGGTGGGACATTGCTGGGGATCCAGGGAGCATCCGGACGCTCCAGTCCAATCTGGGCT
GCCTCCCACCATCCTCGGCTTTGCCCTCTGGGACCAGGAGCCTCCCACGCCCCATTGACGGTGTTTCGGA
CTGGAGCCAAGGGTGCTCCCTGCGATCCACTGGCAGCCCTGCCTCCCTGGCCAGCAACTTGGAAATCAGC
CAGTCCCCTACCATGCCCTTCCTCAGCCTGCACCGCAGCCCACATGGGCCCAGCAAGCTCTGTGACGACC
CCCAGGCCAGCTTGGTGCCCGAGCCTGTCCCCGGTGGCTGCCAGGAGCCTGAGGAGATGAGCTGGCCGCC
ATCGGGGGAGATTGCCAGCCCACCAGAGCTGCCAAGCAGCCCACCTCCTGGGCTTCCCGAAGTGGCCCCA
GATGCAACCTCCACTGGCCTCCCTGATACCCCCGCAGCTCCAGAAACCAGCACCAACTACCCAGTGGAGT
GCACCGAGGGGTCTGCAGGCCCCCAGTCTCTCCCCTTGCCTATTCTGGAGCCGGTCAAAAACCCCTGCTC
TGTCAAAGACCAGACGCCACTCCAACTTTCTGTAGAAGATACCACCTCTCCAAATACCAAGCCGTGCCCA
CCTACTCCCACCACCCCAGAAACATCCCCTCCTCCTCCTCCTCCTCCTCCTTCATCTACTCCTTGTTCAG
CTCACCTGACCCCCTCCTCCCTGTTCCCTTCCTCCCTGGAATCATCATCGGAACAGAAATTCTATAACTT
TGTGATCCTCCACGCCAGGGCAGACGAACACATCGCCCTGCGGGTTCGGGAGAAGCTGGAGGCCCTTGGC
GTGCCCGACGGGGCCACCTTCTGCGAGGATTTCCAGGTGCCGGGGCGCGGGGAGCTGAGCTGCCTGCAGG
ACGCCATAGACCACTCAGCTTTCATCATCCTACTTCTCACCTCCAACTTCGACTGTCGCCTGAGCCTGCA
CCAGGTGAACCAAGCCATGATGAGCAACCTCACGCGACAGGGGTCGCCAGACTGTGTCATCCCCTTCCTG
CCCCTGGAGAGCTCCCCGGCCCAGCTCAGCTCCGACACGGCCAGCCTGCTCTCCGGGCTGGTGCGGCTGG
ACGAACACTCCCAGATCTTCGCCAGGAAGGTGGCCAACACCTTCAAGCCCCACAGGCTTCAGGCCCGAAA
GGCCATGTGGAGGAAGGAACAGGACACCCGAGCCCTGCGGGAACAGAGCCAACACCTGGATGGTGAGCGG
ATGCAGGCGGCGGCACTGAACGCAGCCTACTCAGCCTACCTCCAGAGCTACTTGTCCTACCAGGCACAGA
TGGAGCAGCTCCAGGTGGCTTTTGGGAGCCACATGTCATTTGGGACTGGGGCGCCCTATGGGGCTCGAAT
GCCCTTTGGGGGCCAGGTGCCCCTGGGAGCCCCGCCACCCTTTCCCACTTGGCCGGGGTGCCCGCAGCCG
CCACCCCTGCACGCATGGCAGGCTGGCACCCCCCCACCGCCCTCCCCACAGCCAGCAGCCTTTCCACAGT
CACTGCCCTTCCCGCAGTCCCCAGCCTTCCCTACGGCCTCACCCGCACCCCCTCAGAGCCCAGGGCTGCA
ACCCCTCATTATCCACCACGCACAGATGGTACAGCTGGGGCTGAACAACCACATGTGGAACCAGAGAGGG
TCCCAGGCGCCCGAGGACAAGACGCAGGAGGCAGAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC217522 representing NM_182919
Red=Cloning site Green=Tags(s)

MACTGPSLPSAFDILGAAGQDKLLYLKHKLKTPRPGCQGQDLLHAMVLLKLGQETEARISLEALKADAVA
RLVARQWAGVDSTEDPEEPPDVSWAVARLYHLLAEEKLCPASLRDVAYQEAVRTLSSRDDHRLGELQDEA
RNRCGWDIAGDPGSIRTLQSNLGCLPPSSALPSGTRSLPRPIDGVSDWSQGCSLRSTGSPASLASNLEIS
QSPTMPFLSLHRSPHGPSKLCDDPQASLVPEPVPGGCQEPEEMSWPPSGEIASPPELPSSPPPGLPEVAP
DATSTGLPDTPAAPETSTNYPVECTEGSAGPQSLPLPILEPVKNPCSVKDQTPLQLSVEDTTSPNTKPCP
PTPTTPETSPPPPPPPPSSTPCSAHLTPSSLFPSSLESSSEQKFYNFVILHARADEHIALRVREKLEALG
VPDGATFCEDFQVPGRGELSCLQDAIDHSAFIILLLTSNFDCRLSLHQVNQAMMSNLTRQGSPDCVIPFL
PLESSPAQLSSDTASLLSGLVRLDEHSQIFARKVANTFKPHRLQARKAMWRKEQDTRALREQSQHLDGER
MQAAALNAAYSAYLQSYLSYQAQMEQLQVAFGSHMSFGTGAPYGARMPFGGQVPLGAPPPFPTWPGCPQP
PPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRG
SQAPEDKTQEAE

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_182919
ORF Size 2136 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_182919.4
RefSeq Size 2460 bp
RefSeq ORF 2139 bp
Locus ID 148022
UniProt ID Q8IUC6
Cytogenetics 19p13.3
Protein Families Druggable Genome
Protein Pathways Toll-like receptor signaling pathway
MW 76.2 kDa
Gene Summary This gene encodes an adaptor protein containing a Toll/interleukin-1 receptor (TIR) homology domain, which is an intracellular signaling domain that mediates protein-protein interactions between the Toll-like receptors (TLRs) and signal-transduction components. This protein is involved in native immunity against invading pathogens. It specifically interacts with toll-like receptor 3, but not with other TLRs, and this association mediates dsRNA induction of interferon-beta through activation of nuclear factor kappa-B, during an antiviral immune response. Mutations in this gene are associated with encephalopathy, acute, infection-induced. [provided by RefSeq, Jul 2020]

Other Versions

Other products for "TICAM1"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


TICAM1 (TRIF) mouse monoclonal antibody, clone OTI1G7 (formerly 1G7)
    • 100 ul

USD 417.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.