DGKD (NM_152879) Human Tagged ORF Clone

CAT#: RC217053

Reviews ()
Write a review

DGKD (Myc-DDK-tagged)-Human diacylglycerol kinase, delta 130kDa (DGKD), transcript variant 2



  "NM_152879" in other vectors (4)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 1,439.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol DGKD
Synonyms DGK-delta; dgkd-2; DGKdelta
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC217053 representing NM_152879
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCGGCGGCGGGCGCCCCTCCGCCGGGTCCCCCGCAACCGCCTCCGCCGCCGCCGCCCGAGGAGT
CGTCCGACAGCGAGCCCGAGGCGGAGCCCGGCTCCCCACAGAAGCTCATCCGCAAGGTGTCCACGTCGGG
TCAGATCCGACAGAAGACCATCATCAAAGAGGGGATGCTGACCAAACAGAACAATTCATTCCAGCGATCA
AAAAGGAGATACTTTAAGCTTCGAGGGCGAACGCTTTACTATGCCAAAACGGCAAAGTCAATCATATTTG
ATGAGGTGGATCTGACAGATGCCAGCGTAGCTGAATCCAGTACCAAAAACGTCAACAACAGTTTTACGGT
CATAACTCCATGCAGGAAGCTCATCTTGTGTGCTGATAACAGAAAAGAAATGGAAGATTGGATTGCAGCA
TTAAAGACTGTGCAGAACAGGGAGCACTTTGAGCCCACCCAGTACAGCATGGACCACTTCTCAGGGATGC
ACAATTGGTACGCCTGTTCCCACGCGAGGCCGACCTACTGCAATGTGTGCCGTGAGGCTCTGTCTGGGGT
CACGTCGCACGGGCTGTCCTGCGAGGTGTGCAAATTTAAGGCCCACAAGCGCTGTGCTGTGCGTGCAACC
AATAACTGCAAGTGGACCACACTGGCCTCGATCGGGAAGGACATCATTGAAGATGCAGATGGGATTGCAA
TGCCCCACCAGTGGTTGGAAGGAAACCTACCTGTGAGCGCCAAGTGCACTGTGTGCGACAAGACCTGTGG
CAGTGTGCTGCGCCTGCAGGACTGGCGCTGCCTCTGGTGCAAGGCCATGGTTCACACATCGTGTAAAGAA
TCCTTGCTGACCAAGTGCCCACTTGGCCTGTGCAAAGTGTCAGTCATCCCACCCACGGCTCTCAACAGCA
TCGACTCCGATGGGTTCTGGAAGGCCAGCTGTCCTCCTTCTTGCACAAGCCCACTGTTGGTCTTCGTCAA
TTCAAAAAGTGGGGACAACCAGGGTGTGAAGTTCCTCAGAAGATTCAAACAGCTACTAAACCCCGCCCAG
GTCTTCGACCTCATGAACGGAGGCCCACACCTCGGCTTACGGTTATTCCAGAAGTTTGACACATTCCGGA
TTCTGGTTTGTGGCGGGGATGGAAGTGTTGGCTGGGTCCTCTCCGAAATCGACAGCCTCAACCTTCATAA
ACAGTGTCAGCTGGGAGTGCTGCCGCTCGGCACAGGGAACGACTTGGCCCGAGTACTGGGCTGGGGCTCA
GCCTGCGATGACGACACCCAGCTCCCCCAGATCTTGGAGAAGTTGGAGAGAGCCAGCACCAAGATGCTGG
ACAGGTGGAGCGTCATGGCATACGAGGCCAAGCTCCCCCGGCAGGCCTCCTCCTCTACCGTCACCGAAGA
CTTCAGCGAGGATTCCGAGGTACAGCAGATTCTCTTCTATGAAGACTCGGTTGCAGCCCACCTTTCTAAA
ATCCTCACCTCGGACCAGCACTCGGTGGTCATCTCCTCGGCCAAAGTGCTCTGTGAGACGGTGAAGGACT
TCGTGGCACGGGTGGGGAAGGCCTATGAGAAGACGACCGAGAGCTCGGAGGAGTCAGAGGTCATGGCCAA
GAAGTGCTCTGTCCTGAAAGAGAAGCTGGATTCCCTTCTCAAGACCTTGGACGATGAGTCCCAGGCCTCG
TCCTCTCTGCCCAACCCGCCCCCCACCATTGCCGAGGAGGCTGAAGATGGAGATGGGTCGGGCAGCATCT
GCGGTTCCACCGGAGACCGCTTGGTGGCATCAGCTTGCCCGGCCCGGCCGCAGATATTCCGGCCTCGAGA
ACAGCTCATGCTGAGAGCCAACAGCCTGAAGAAAGCAATTCGTCAGATCATAGAACACACAGAAAAAGCT
GTCGATGAGCAGAATGCCCAGACCCAGGAGCAGGAGGGCTTCGTCCTGGGCCTCTCTGAGTCAGAGGAGA
AGATGGACCACAGAGTGTGCCCACCACTGTCCCACAGCGAGAGCTTCGGGGTCCCCAAGGGGAGGAGCCA
GCGCAAAGTGTCGAAATCTCCGTGTGAAAAGCTGATCAGCAAAGGGAGTCTGTCCCTAGGCAGTTCTGCT
TCCCTTCCGCCCCAGCCGGGAAGCCGGGACGGCCTGCCTGCGCTCAACACCAAGATCCTGTACCCAAATG
TCCGGGCTGGAATGTCTGGTTCCTTACCCGGTGGCTCAGTCATCAGTCGCCTGTTAATTAATGCTGATCC
CTTCAACTCTGAACCAGAAACCCTAGAGTATTACACGGAGAAATGTGTCATGAACAACTATTTTGGCATT
GGCCTGGATGCGAAGATATCCCTGGACTTTAACAACAAGCGCGATGAGCACCCAGAGAAGTGCAGGAGCC
GAACCAAGAACATGATGTGGTATGGAGTTCTTGGAACCAAAGAGTTGCTGCACAGAACCTACAAGAACCT
GGAGCAAAAGGTCTTGCTGGAGTGTGACGGGCGACCCATCCCACTCCCCAGTCTTCAGGGAATTGCTGTC
CTTAACATTCCCAGCTATGCCGGAGGAACCAACTTCTGGGGGGGTACCAAGGAAGATGATACTTTCGCAG
CTCCATCATTCGATGACAAGATTCTGGAGGTGGTCGCCGTGTTCGGCAGCATGCAGATGGCCGTCTCTCG
AGTCATCAGGCTACAGCATCATCGGATCGCCCAGTGTCGCACGGTGAAGATCTCCATCCTTGGGGATGAG
GGCGTGCCTGTGCAGGTGGACGGAGAGGCCTGGGTCCAGCCGCCAGGGTACATTCGGATTGTCCACAAGA
ACCGGGCACAGACACTGACCAGAGACAGGGCATTTGAGAGCACCCTGAAGTCCTGGGAAGACAAGCAGAA
GTGCGAGCTGCCCCGCCCTCCATCCTGTTCCCTGCACCCGGAGATGCTGTCCGAGGAGGAGGCCACCCAG
ATGGACCAGTTTGGGCAGGCAGCAGGGGTCCTCATTCACAGTATCCGAGAAATAGCTCAGTCTCACCGGG
ACATGGAGCAGGAACTGGCCCACGCCGTCAATGCCAGCTCCAAGTCCATGGACCGTGTGTATGGCAAGCC
CAGAACCACAGAGGGGCTCAACTGCAGCTTCGTCCTGGAAATGGTGAATAACTTCAGAGCTCTGCGCAGT
GAGACGGAGCTGCTGCTGTCTGGGAAGATGGCCCTGCAGCTGGATCCGCCTCAGAAGGAGCAGCTGGGGA
GTGCTCTTGCCGAGATGGACCGACAGCTCAGGAGGCTGGCAGACACCCCGTGGCTCTGCCAGTCCGCAGA
GCCCGGCGACGAAGAGAGTGTGATGCTGGATCTTGCCAAGCGCAGTCGCAGTGGTAAATTCCGCCTCGTG
ACCAAGTTTAAAAAGGAGAAAAACAACAAGAACAAAGAAGCTCACAGTAGCCTGGGAGCCCCGGTTCACC
TCTGGGGGACAGAGGAGGTTGCTGCCTGGCTGGAGCACCTCAGTCTCTGTGAGTATAAGGACATCTTCAC
ACGGCACGACATCCGGGGCTCTGAGCTCCTGCACCTGGAGCGGAGGGACCTCAAGGACCTGGGCGTGACC
AAGGTGGGCCACATGAAGAGGATCCTGTGTGGCATCAAGGAGCTGAGCCGCAGCGCCCCCGCCGTCGAGG
CC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC217053 representing NM_152879
Red=Cloning site Green=Tags(s)

MAAAAGAPPPGPPQPPPPPPPEESSDSEPEAEPGSPQKLIRKVSTSGQIRQKTIIKEGMLTKQNNSFQRS
KRRYFKLRGRTLYYAKTAKSIIFDEVDLTDASVAESSTKNVNNSFTVITPCRKLILCADNRKEMEDWIAA
LKTVQNREHFEPTQYSMDHFSGMHNWYACSHARPTYCNVCREALSGVTSHGLSCEVCKFKAHKRCAVRAT
NNCKWTTLASIGKDIIEDADGIAMPHQWLEGNLPVSAKCTVCDKTCGSVLRLQDWRCLWCKAMVHTSCKE
SLLTKCPLGLCKVSVIPPTALNSIDSDGFWKASCPPSCTSPLLVFVNSKSGDNQGVKFLRRFKQLLNPAQ
VFDLMNGGPHLGLRLFQKFDTFRILVCGGDGSVGWVLSEIDSLNLHKQCQLGVLPLGTGNDLARVLGWGS
ACDDDTQLPQILEKLERASTKMLDRWSVMAYEAKLPRQASSSTVTEDFSEDSEVQQILFYEDSVAAHLSK
ILTSDQHSVVISSAKVLCETVKDFVARVGKAYEKTTESSEESEVMAKKCSVLKEKLDSLLKTLDDESQAS
SSLPNPPPTIAEEAEDGDGSGSICGSTGDRLVASACPARPQIFRPREQLMLRANSLKKAIRQIIEHTEKA
VDEQNAQTQEQEGFVLGLSESEEKMDHRVCPPLSHSESFGVPKGRSQRKVSKSPCEKLISKGSLSLGSSA
SLPPQPGSRDGLPALNTKILYPNVRAGMSGSLPGGSVISRLLINADPFNSEPETLEYYTEKCVMNNYFGI
GLDAKISLDFNNKRDEHPEKCRSRTKNMMWYGVLGTKELLHRTYKNLEQKVLLECDGRPIPLPSLQGIAV
LNIPSYAGGTNFWGGTKEDDTFAAPSFDDKILEVVAVFGSMQMAVSRVIRLQHHRIAQCRTVKISILGDE
GVPVQVDGEAWVQPPGYIRIVHKNRAQTLTRDRAFESTLKSWEDKQKCELPRPPSCSLHPEMLSEEEATQ
MDQFGQAAGVLIHSIREIAQSHRDMEQELAHAVNASSKSMDRVYGKPRTTEGLNCSFVLEMVNNFRALRS
ETELLLSGKMALQLDPPQKEQLGSALAEMDRQLRRLADTPWLCQSAEPGDEESVMLDLAKRSRSGKFRLV
TKFKKEKNNKNKEAHSSLGAPVHLWGTEEVAAWLEHLSLCEYKDIFTRHDIRGSELLHLERRDLKDLGVT
KVGHMKRILCGIKELSRSAPAVEA

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_152879
ORF Size 3642 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_152879.3
RefSeq Size 6294 bp
RefSeq ORF 3645 bp
Locus ID 8527
UniProt ID Q16760
Cytogenetics 2q37.1
Protein Families Druggable Genome
Protein Pathways Glycerolipid metabolism, Glycerophospholipid metabolism, Metabolic pathways, Phosphatidylinositol signaling system
MW 134.3 kDa
Gene Summary This gene encodes a cytoplasmic enzyme that phosphorylates diacylglycerol to produce phosphatidic acid. Diacylglycerol and phosphatidic acid are two lipids that act as second messengers in signaling cascades. Their cellular concentrations are regulated by the encoded protein, and so it is thought to play an important role in cellular signal transduction. Alternative splicing results in two transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]

Other Versions

Other products for "DGKD"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


DGKD rabbit polyclonal antibody
    • 25 ul

USD 800.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.