ANKLE2 (NM_015114) Human Tagged ORF Clone

CAT#: RC216867

Reviews ()
Write a review

ANKLE2 (Myc-DDK-tagged)-Human ankyrin repeat and LEM domain containing 2 (ANKLE2)



  "NM_015114" in other vectors (6)

USD 420.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name ANKLE2 (NM_015114) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ANKLE2
Synonyms KIAA0692; Lem4; LEMD7; MCPH16
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC216867 representing NM_015114
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGTGGCCGCGGCTGGCGGCGGCCGAGTGGGCGGCGCTGGCCTGGGAGCTGCTGGGCGCCTCGGTGC
TGCTGATCGCTGTGCGGTGGCTGGTGCGGCGGCTGGGCCCGCGGCCGGGAGGTCTGGGCCGCAGCGGGAC
CCCAGTTCCTCCGCCAAGCGCGGCCGCCGCCCCCGCCTCAGGTGAAATGACAATGGATGCTCTGTTGGCT
CGATTGAAACTTCTGAATCCAGATGACCTTAGAGAAGAAATCGTCAAAGCCGGATTGAAATGTGGACCCA
TTACATCAACTACAAGGTTCATTTTTGAGAAAAAATTGGCTCAGGCTTTACTGGAGCAAGGAGGAAGGCT
GTCTTCTTTCTACCACCATGAGGCAGGTGTCACAGCTCTCAGCCAGGACCCACAAAGGATTTTGAAGCCA
GCTGAAGGGAACCCAACTGATCAGGCTGGTTTTTCTGAAGACAGAGATTTTGGTTACAGTGTGGGCCTGA
ATCCTCCAGAGGAGGAAGCTGTGACATCCAAGACCTGCTCGGTGCCCCCTAGTGACACCGACACCTACAG
AGCTGGAGCGACTGCGTCTAAGGAGCCGCCCCTGTACTATGGGGTGTGTCCAGTGTATGAGGACGTCCCA
GCGAGAAATGAAAGGATCTATGTTTATGAAAATAAAAAGGAAGCATTGCAAGCTGTCAAGATGATCAAAG
GGTCCCGATTTAAAGCTTTTTCTACCAGAGAAGACGCTGAGAAATTTGCTAGAGGAATTTGTGATTATTT
CCCTTCTCCAAGCAAAACGTCCTTACCACTGTCTCCTGTGAAAACAGCTCCACTCTTTAGCAATGACAGG
TTGAAAGATGGTTTGTGCTTGTCGGAATCAGAAACAGTCAACAAAGAGCGAGCGAACAGTTACAAAAATC
CCCGCACGCAGGACCTCACCGCCAAGCTTCGGAAAGCTGTGGAGAAGGGAGAGGAGGACACCTTTTCTGA
CCTTATCTGGAGCAACCCCCGGTATCTGATAGGCTCAGGAGACAACCCCACTATCGTGCAGGAAGGGTGC
AGGTACAACGTGATGCATGTTGCTGCCAAAGAGAACCAGGCTTCCATCTGCCAGCTGACTCTGGACGTCC
TGGAGAACCCTGACTTCATGAGGCTGATGTACCCTGATGACGACGAGGCCATGCTGCAGAAGCGTATCCG
TTACGTGGTGGACCTGTACCTCAACACCCCCGACAAGATGGGCTATGACACACCGTTGCATTTTGCTTGT
AAGTTTGGAAATGCAGATGTAGTCAACGTGCTTTCGTCACACCATTTGATTGTAAAAAACTCAAGGAATA
AATATGATAAAACACCTGAAGATGTAATTTGTGAAAGAAGCAAAAATAAATCTGTGGAACTGAAGGAGCG
GATCAGAGAGTATTTAAAGGGCCACTACTACGTGCCCCTCCTGAGAGCGGAAGAGACTTCTTCTCCAGTC
ATCGGGGAGCTGTGGTCCCCAGACCAGACGGCTGAGGCCTCTCACGTCAGCCGCTATGGAGGCAGCCCCA
GAGACCCGGTACTGACCCTGAGAGCCTTCGCAGGGCCCCTGAGTCCAGCCAAGGCAGAAGATTTTCGCAA
GCTCTGGAAAACTCCACCTCGAGAGAAAGCAGGCTTCCTTCACCACGTCAAGAAGTCGGACCCGGAAAGA
GGCTTTGAGAGAGTGGGAAGGGAGCTAGCTCATGAGCTGGGGTATCCCTGGGTTGAATACTGGGAATTTC
TGGGCTGTTTTGTTGATCTGTCTTCCCAGGAAGGCCTGCAAAGACTAGAAGAATATCTCACACAGCAGGA
AATAGGCAAAAAGGCTCAACAAGAAACAGGAGAACGGGAAGCCTCCTGCCGAGATAAAGCCACCACGTCT
GGCAGCAATTCCATTTCCGTGAGGGCGTTTCTAGATGAAGATGACATGAGCTTGGAAGAAATAAAAAATC
GGCAAAATGCAGCTCGAAATAACAGCCCGCCCACAGTCGGTGCTTTTGGACATACGAGGTGCAGCGCCTT
CCCCTTGGAGCAGGAGGCAGACCTCATAGAAGCCGCCGAGCCGGGAGGTCCACACAGCAGCAGAAATGGG
CTCTGCCATCCTCTGAATCACAGCAGGACCCTGGCGGGCAAGAGACCAAAGGCCCCCCGTGGGGAGGAAG
CCCATCTGCCACCTGTCTCGGATTTGACTGTTGAGTTTGATAAACTGAATTTGCAAAATATAGGACGTAG
CGTTTCCAAGACACCAGATGAAAGTACAAAAACTAAAGATCAGATCCTGACTTCAAGAATCAATGCAGTA
GAAAGAGACTTGTTAGAGCCTTCTCCCGCAGACCAACTCGGGAATGGCCACAGGAGGACAGAAAGTGAAA
TGTCAGCCAGGATCGCTAAAATGTCCTTGAGTCCCAGCAGCCCCAGGCACGAGGATCAGCTCGAGGTCAC
CAGGGAACCGGCCAGGCGGCTCTTCCTTTTTGGAGAGGAGCCATCAAAACTCGATCAGGATGTTTTGGCC
GCTCTTGAATGTGCAGACGTCGACCCCCATCAGTTCCCGGCCGTGCACAGATGGAAGAGTGCTGTCCTGT
GCTACTCACCCTCGGACAGACAGAGTTGGCCCAGTCCCGCGGTGAAAGGAAGGTTCAAGTCTCAGCTGCC
AGATCTCAGTGGCCCTCACAGCTACAGTCCGGGGAGAAACAGCGTGGCTGGAAGCAACCCCGCAAAGCCA
GGCCTGGGCAGTCCTGGGCGCTACAGCCCCGTGCACGGGAGCCAGCTCCGCAGGATGGCGCGCCTGGCTG
AGCTTGCCGCCCTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC216867 representing NM_015114
Red=Cloning site Green=Tags(s)

MLWPRLAAAEWAALAWELLGASVLLIAVRWLVRRLGPRPGGLGRSGTPVPPPSAAAAPASGEMTMDALLA
RLKLLNPDDLREEIVKAGLKCGPITSTTRFIFEKKLAQALLEQGGRLSSFYHHEAGVTALSQDPQRILKP
AEGNPTDQAGFSEDRDFGYSVGLNPPEEEAVTSKTCSVPPSDTDTYRAGATASKEPPLYYGVCPVYEDVP
ARNERIYVYENKKEALQAVKMIKGSRFKAFSTREDAEKFARGICDYFPSPSKTSLPLSPVKTAPLFSNDR
LKDGLCLSESETVNKERANSYKNPRTQDLTAKLRKAVEKGEEDTFSDLIWSNPRYLIGSGDNPTIVQEGC
RYNVMHVAAKENQASICQLTLDVLENPDFMRLMYPDDDEAMLQKRIRYVVDLYLNTPDKMGYDTPLHFAC
KFGNADVVNVLSSHHLIVKNSRNKYDKTPEDVICERSKNKSVELKERIREYLKGHYYVPLLRAEETSSPV
IGELWSPDQTAEASHVSRYGGSPRDPVLTLRAFAGPLSPAKAEDFRKLWKTPPREKAGFLHHVKKSDPER
GFERVGRELAHELGYPWVEYWEFLGCFVDLSSQEGLQRLEEYLTQQEIGKKAQQETGEREASCRDKATTS
GSNSISVRAFLDEDDMSLEEIKNRQNAARNNSPPTVGAFGHTRCSAFPLEQEADLIEAAEPGGPHSSRNG
LCHPLNHSRTLAGKRPKAPRGEEAHLPPVSDLTVEFDKLNLQNIGRSVSKTPDESTKTKDQILTSRINAV
ERDLLEPSPADQLGNGHRRTESEMSARIAKMSLSPSSPRHEDQLEVTREPARRLFLFGEEPSKLDQDVLA
ALECADVDPHQFPAVHRWKSAVLCYSPSDRQSWPSPAVKGRFKSQLPDLSGPHSYSPGRNSVAGSNPAKP
GLGSPGRYSPVHGSQLRRMARLAELAAL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_015114
ORF Size 2814 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_015114.1, NM_015114.2, NP_055929.1
RefSeq Size 4491 bp
RefSeq ORF 2817 bp
Locus ID 23141
Cytogenetics 12q24.33
Protein Families Transmembrane
MW 104.1 kDa
Gene Summary This gene encodes a member of the LEM family of inner nuclear membrane proteins. The encoded protein functions as a mitotic regulator through postmitotic formation of the nuclear envelope. Mutations in this gene cause morphology defects in the nuclear envelope and BAF hyperphosphorylation. [provided by RefSeq, Mar 2014]

Citations (1)

Other Versions

Other products for "ANKLE2"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Chicken Polyclonal ANKLE2 Antibody
    • 100 ug

USD 430.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools