DUSP4 (NM_057158) Human Tagged ORF Clone

CAT#: RC215252

DUSP4 (Myc-DDK-tagged)-Human dual specificity phosphatase 4 (DUSP4), transcript variant 2

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro

AAV Particle: DDK


  "NM_057158" in other vectors (6)

Reconstitution Protocol

USD 300.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


DUSP4 mouse monoclonal antibody,clone OTI7C11
    • 100 ul

USD 447.00

Other products for "DUSP4"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol DUSP4
Synonyms HVH2; MKP-2; MKP2; TYP
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC215252 representing NM_057158
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGAAGAAAAGTTCACTCCAACGGAAGCCAGTTTGCTGAACATAGCAGATCGCCCAGGAGGACTGGGA
GAGACTGCAAACCAGTTCGAGCCCCCAGCATGGCGTTAGGTGTCAGCCAGCTGGCAGGAAGGTCCAGGTG
TCTGTGTTCAGAGTCTCAAGGCGGCTATGAGAGGTTTTCCTCCGAGTACCCAGAATTCTGTTCTAAAACC
AAGGCCCTGGCAGCCATCCCACCCCCGGTTCCCCCCAGTGCCACAGAGCCCTTGGACCTGGGCTGCAGCT
CCTGTGGGACCCCACTACACGACCAGGGGGGTCCTGTGGAGATCCTTCCCTTCCTCTACCTCGGCAGTGC
CTACCATGCTGCCCGGAGAGACATGCTGGACGCCCTGGGCATCACGGCTCTGTTGAATGTCTCCTCGGAC
TGCCCAAACCACTTTGAAGGACACTATCAGTACAAGTGCATCCCAGTGGAAGATAACCACAAGGCCGACA
TCAGCTCCTGGTTCATGGAAGCCATAGAGTACATCGATGCCGTGAAGGACTGCCGTGGGCGCGTGCTGGT
GCACTGCCAGGCGGGCATCTCGCGGTCGGCCACCATCTGCCTGGCCTACCTGATGATGAAGAAACGGGTG
AGGCTGGAGGAGGCCTTCGAGTTCGTTAAGCAGCGCCGCAGCATCATCTCGCCCAACTTCAGCTTCATGG
GGCAGCTGCTGCAGTTCGAGTCCCAGGTGCTGGCCACGTCCTGTGCTGCGGAGGCTGCTAGCCCCTCGGG
ACCCCTGCGGGAGCGGGGCAAGACCCCCGCCACCCCCACCTCGCAGTTCGTCTTCAGCTTTCCGGTCTCC
GTGGGCGTGCACTCGGCCCCCAGCAGCCTGCCCTACCTGCACAGCCCCATCACCACCTCTCCCAGCTGT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC215252 representing NM_057158
Red=Cloning site Green=Tags(s)

MGRKVHSNGSQFAEHSRSPRRTGRDCKPVRAPSMALGVSQLAGRSRCLCSESQGGYERFSSEYPEFCSKT
KALAAIPPPVPPSATEPLDLGCSSCGTPLHDQGGPVEILPFLYLGSAYHAARRDMLDALGITALLNVSSD
CPNHFEGHYQYKCIPVEDNHKADISSWFMEAIEYIDAVKDCRGRVLVHCQAGISRSATICLAYLMMKKRV
RLEEAFEFVKQRRSIISPNFSFMGQLLQFESQVLATSCAAEAASPSGPLRERGKTPATPTSQFVFSFPVS
VGVHSAPSSLPYLHSPITTSPSC

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_057158
ORF Size 909 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_057158.3
RefSeq Size 3404 bp
RefSeq ORF 912 bp
Locus ID 1846
UniProt ID Q13115
Cytogenetics 8p12
Protein Families Phosphatase
Protein Pathways MAPK signaling pathway
MW 32.8 kDa
Gene Summary The protein encoded by this gene is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the mitogen-activated protein (MAP) kinase superfamily (MAPK/ERK, SAPK/JNK, p38), which are associated with cellular proliferation and differentiation. Different members of the family of dual specificity phosphatases show distinct substrate specificities for various MAP kinases, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli. This gene product inactivates ERK1, ERK2 and JNK, is expressed in a variety of tissues, and is localized in the nucleus. Two alternatively spliced transcript variants, encoding distinct isoforms, have been observed for this gene. In addition, multiple polyadenylation sites have been reported. [provided by RefSeq, Jul 2008]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.