FGD6 (NM_018351) Human Tagged ORF Clone

CAT#: RC213023

FGD6 (Myc-DDK-tagged)-Human FYVE, RhoGEF and PH domain containing 6 (FGD6)

  • TrueORF®

Need custom modification / cloning service?
Get a free quote

USD 1,999.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name FGD6 (NM_018351) Human Tagged ORF Clone
Symbol FGD6
Synonyms ZFYVE24; ZFYVE24
Vector pCMV6-Entry
Sequence Data
>RC213023 representing NM_018351
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACTTCTGCAGCCGAGATAAAGAAGCCACCAGTGGCCCCCAAGCCCAAGTTTGTTGTGGCAAATAATA
AGCCAGCCCCACCTCCTATTGCACCTAAACCCGACATTGTGATTTCTAGTGTTCCACAGTCGACAAAGAA
AATGAAACCAGCAATAGCCCCAAAACCAAAAGTCCTGAAGACCTCACCTGTTCGAGAGATTGGGCAGTCG
CCATCAAGGAAAATCATGTTGAACCTGGAAGGGCATAAACAGGAATTAGCTGAAAGCACTGACAACTTTA
ATTGTAAATATGAAGGCAATCAGAGCAATGATTATATTTCACCAATGTGTTCCTGCAGTTCTGAGTGTAT
CCATAAGCTGGGCCATAGAGAGAATTTGTGTGTAAAGCAGCTTGTTTTAGAGCCCCTGGAAATGAATGAA
AATTTAGAAAACAGTAAAATTGATGAGACTTTGACTATAAAAACTAGGAGTAAATGTGATTTGTATGGTG
AAAAAGCCAAGAACCAGGGTGGGGTTGTTTTAAAGGCAAGCGTTTTAGAAGAGGAGCTCAAAGATGCCTT
AATACACCAAATGCCACCTTTTATTTCTGCACAGAAGCACAGGCCCACAGACAGCCCAGAAATGAATGGT
GGCTGTAATTCAAATGGACAATTCAGAATTGAATTTGCGGATTTGTCACCTTCCCCATCCAGCTTTGAAA
AAGTTCCTGATCATCACAGTTGCCACTTACAGCTTCCTAGTGATGAATGTGAACATTTTGAAACTTGCCA
GGATGACAGTGAAAAAAGCAATAATTGCTTTCAGTCATCTGAACTAGAGGCTCTGGAAAATGGGAAAAGG
AGTACTTTAATATCTTCAGATGGAGTTAGTAAGAAATCAGAAGTCAAAGACCTTGGTCCCTTAGAAATTC
ATTTAGTACCATATACCCCAAAATTTCCAACTCCCAAGCCCAGAAAGACACGAACTGCTCGTCTGTTACG
CCAAAAGTGTGTAGATACTCCTAGTGAAAGCACTGAAGAACCGGGGAATTCAGACAGTAGCTCTTCCTGT
CTTACTGAAAATAGTTTGAAAATCAATAAAATCAGTGTTCTGCATCAGAATGTTTTGTGTAAGCAGGAAC
AGGTGGATAAAATGAAGCTAGGAAATAAAAGTGAATTGAATATGGAATCCAACAGTGATGCACAGGACTT
AGTCAATTCACAGAAAGCCATGTGTAATGAAACAACTTCCTTTGAAAAAATGGCACCTTCTTTTGATAAA
GACTCTAATTTGAGTTCTGACAGCACAACTGTAGATGGTTCTAGTATGTCGCTTGCTGTGGACGAAGGGA
CCGGTTTTATAAGATGTACTGTATCTATGAGCCTGCCTAAGCAGCTCAAATTAACTTGCAATGAACATTT
GCAATCTGGGAGAAACCTGGGAGTTTCTGCCCCTCAAATGCAAAAGGAATCTGTTATAAAAGAGGAAAAT
TCTCTACGAATTGTCCCCAAAAAACCTCAAAGACATAGCTTGCCTGCTACAGGAGTGCTTAAAAAGGCTG
CCTCCGAGGAGCTTTTGGAAAAAAGTTCTTATCCTTCAAGTGAAGAAAAAAGTTCAGAGAAGAGTCTAGA
AAGAAATCACCTTCAGCATTTGTGTGCCCAAAACCGTGGTGTGTCATCCTCCTTTGATATGCCTAAACGG
GCTTCAGAAAAGCCAGTGTGGAAGTTACCTCATCCTATTTTACCCTTTTCAGGGAACCCAGAATTCTTAA
AGTCTGTCACCGTATCGTCAAACAGTGAGCCTTCAACAGCCCTAACCAAGCCCAGAGCAAAATCGTTATC
TGCTATGGATGTGGAAAAGTGCACTAAGCCTTGCAAAGACTCTACAAAGAAAAACTCTTTTAAAAAGTTG
CTCAGCATGAAACTGTCCATCTGTTTCATGAAGAGTGACTTTCAAAAATTTTGGTCCAAGAGTAGCCAAC
TCGGAGACACCACCACAGGCCACCTCTCCAGTGGGGAGCAGAAGGGGATTGAAAGTGATTGGCAAGGCTT
GTTGGTAGGAGAGGAGAAGAGAAGTAAACCCATCAAGGCATATTCCACAGAAAACTATAGCCTGGAATCT
CAAAAGAAGAGGAAGAAGTCTCGGGGCCAGACCAGTGCAGCTAATGGTCTGAGAGCTGAGTCTTTGGATG
ACCAAATGCTCTCCCGGGAGTCATCATCTCAGGCACCTTACAAGTCTGTTACAAGCCTCTGTGCACCGGA
GTATGAAAATATACGCCATTATGAGGAAATACCAGAGTACGAGAACTTGCCATTTATTATGGCTATACGG
AAAACTCAAGAGTTGGAATGGCAGAATTCCAGCAGCATGGAGGACGCTGATGCAAATGTGTATGAGGTAG
AAGAGCCGTATGAAGCTCCAGATGGCCAGCTGCAGCTTGGACCCAGACATCAGCATTCCAGTTCAGGAGC
ATCCCAGGAGGAACAGAATGATCTTGGTCTTGGTGACCTTCCCTCTGATGAGGAGGAAATCATCAACAGT
TCTGATGAAGATGATGTCAGCTCTGAGTCAAGTAAAGGAGAGCCTGACCCACTGGAAGATAAACAGGATG
AAGATAATGGAATGAAAAGTAAAGTTCATCATATTGCCAAGGAGATCATGAGCTCAGAGAAAGTGTTTGT
GGATGTGTTAAAACTTTTGCATATTGATTTCCGGGATGCAGTAGCTCATGCTTCCAGGCAACTTGGGAAA
CCAGTGATTGAGGACCGGATTCTAAATCAGATCCTATACTACTTGCCTCAGCTGTATGAGCTCAACCGGG
ATCTCTTGAAGGAACTGGAGGAAAGAATGTTGCACTGGACTGAACAACAAAGAATTGCTGATATCTTTGT
AAAGAAGGGACCATATCTAAAAATGTATTCCACATACATCAAAGAATTTGATAAGAATATAGCCTTGCTG
GATGAACAGTGCAAGAAAAATCCAGGTTTTGCTGCTGTTGTTAGAGAATTTGAGATGAGCCCTCGCTGTG
CTAATCTGGCCCTCAAGCACTACCTGCTCAAGCCGGTTCAGAGGATCCCCCAGTACAGGCTGTTGCTGAC
AGATTATTTGAAGAATCTCATAGAAGATGCTGGAGATTACAGAGACACTCAAGATGCCCTTGCTGTTGTT
ATAGAGGTAGCCAACCACGCCAATGACACCATGAAGCAAGGAGACAACTTTCAGAAACTTATGCAAATTC
AGTACAGCTTAAATGGACACCATGAAATTGTGCAGCCTGGTCGGGTTTTTCTCAAAGAAGGAATTCTGAT
GAAGCTGTCTCGGAAAGTGATGCAACCTCGAATGTTTTTCCTGTTTAATGATGCCCTGCTGTATACAACA
CCAGTGCAGTCTGGGATGTATAAACTGAACAACATGCTCTCACTGGCTGGAATGAAGGTCAGAAAACCTA
CCCAAGAAGCCTATCAGAATGAATTAAAGATTGAAAGTGTAGAACGTTCCTTCATTCTCTCAGCCAGTTC
TGCCACAGAAAGGGATGAATGGCTAGAAGCGATTTCCAGGGCAATAGAAGAGTATGCCAAGAAAAGAATC
ACCTTCTGTCCTAGTAGGAGTCTTGATGAGGCAGACTCAGAAAATAAAGAAGAAGTTAGTCCTCTTGGAT
CGAAGGCTCCCATCTGGATTCCTGATACCAGAGCCACAATGTGTATGATCTGCACAAGCGAATTCACTCT
CACCTGGAGACGACACCACTGCCGGGCCTGTGGAAAGATTGTATGCCAAGCTTGTTCGTCTAATAAGTAT
GGCTTAGATTACCTGAAAAATCAACCAGCAAGAGTATGTGAACATTGTTTCCAAGAACTGCAGAAATTAG
ATCACCAGCACTCCCCTAGGATTGGATCTCCTGGAAATCACAAATCTCCTTCAAGTGCCTTATCATCAGT
CTTACATAGCATTCCATCAGGGAGGAAACAGAAAAAAATCCCAGCTGCTCTCAAAGAAGTATCAGCAAAC
ACAGAGGATTCTTCTATGAGTGGCTACTTGTACAGATCAAAGGGCAATAAAAAACCCTGGAAACACTTTT
GGTTTGTCATAAAAAATAAAGTACTATATACATATGCTGCAAGTGAGGACGTGGCCGCTTTGGAGAGTCA
GCCTTTATTAGGATTCACTGTTATTCAAGTTAAAGATGAGAATTCCGAGTCTAAAGTATTTCAGTTACTG
CACAAAAACATGTTATTTTATGTATTCAAAGCAGAGGATGCTCATTCGGCTCAGAAGTGGATAGAAGCAT
TTCAGGAAGGCACAATATTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC213023 representing NM_018351
Red=Cloning site Green=Tags(s)

MTSAAEIKKPPVAPKPKFVVANNKPAPPPIAPKPDIVISSVPQSTKKMKPAIAPKPKVLKTSPVREIGQS
PSRKIMLNLEGHKQELAESTDNFNCKYEGNQSNDYISPMCSCSSECIHKLGHRENLCVKQLVLEPLEMNE
NLENSKIDETLTIKTRSKCDLYGEKAKNQGGVVLKASVLEEELKDALIHQMPPFISAQKHRPTDSPEMNG
GCNSNGQFRIEFADLSPSPSSFEKVPDHHSCHLQLPSDECEHFETCQDDSEKSNNCFQSSELEALENGKR
STLISSDGVSKKSEVKDLGPLEIHLVPYTPKFPTPKPRKTRTARLLRQKCVDTPSESTEEPGNSDSSSSC
LTENSLKINKISVLHQNVLCKQEQVDKMKLGNKSELNMESNSDAQDLVNSQKAMCNETTSFEKMAPSFDK
DSNLSSDSTTVDGSSMSLAVDEGTGFIRCTVSMSLPKQLKLTCNEHLQSGRNLGVSAPQMQKESVIKEEN
SLRIVPKKPQRHSLPATGVLKKAASEELLEKSSYPSSEEKSSEKSLERNHLQHLCAQNRGVSSSFDMPKR
ASEKPVWKLPHPILPFSGNPEFLKSVTVSSNSEPSTALTKPRAKSLSAMDVEKCTKPCKDSTKKNSFKKL
LSMKLSICFMKSDFQKFWSKSSQLGDTTTGHLSSGEQKGIESDWQGLLVGEEKRSKPIKAYSTENYSLES
QKKRKKSRGQTSAANGLRAESLDDQMLSRESSSQAPYKSVTSLCAPEYENIRHYEEIPEYENLPFIMAIR
KTQELEWQNSSSMEDADANVYEVEEPYEAPDGQLQLGPRHQHSSSGASQEEQNDLGLGDLPSDEEEIINS
SDEDDVSSESSKGEPDPLEDKQDEDNGMKSKVHHIAKEIMSSEKVFVDVLKLLHIDFRDAVAHASRQLGK
PVIEDRILNQILYYLPQLYELNRDLLKELEERMLHWTEQQRIADIFVKKGPYLKMYSTYIKEFDKNIALL
DEQCKKNPGFAAVVREFEMSPRCANLALKHYLLKPVQRIPQYRLLLTDYLKNLIEDAGDYRDTQDALAVV
IEVANHANDTMKQGDNFQKLMQIQYSLNGHHEIVQPGRVFLKEGILMKLSRKVMQPRMFFLFNDALLYTT
PVQSGMYKLNNMLSLAGMKVRKPTQEAYQNELKIESVERSFILSASSATERDEWLEAISRAIEEYAKKRI
TFCPSRSLDEADSENKEEVSPLGSKAPIWIPDTRATMCMICTSEFTLTWRRHHCRACGKIVCQACSSNKY
GLDYLKNQPARVCEHCFQELQKLDHQHSPRIGSPGNHKSPSSALSSVLHSIPSGRKQKKIPAALKEVSAN
TEDSSMSGYLYRSKGNKKPWKHFWFVIKNKVLYTYAASEDVAALESQPLLGFTVIQVKDENSESKVFQLL
HKNMLFYVFKAEDAHSAQKWIEAFQEGTIL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_018351
ORF Size 4290 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_018351.2, NM_018351.3, NP_060821
RefSeq Size 4996
RefSeq ORF 4293
Locus ID 55785
Cytogenetics 12q22
Domains FYVE, PH
MW 160.6 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)