CSK (NM_004383) Human Tagged ORF Clone

CAT#: RC210758

Reviews ()
Write a review

CSK (Myc-DDK-tagged)-Human c-src tyrosine kinase (CSK), transcript variant 1



Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 477.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol CSK
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC210758 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCAGCAATACAGGCCGCCTGGCCATCCGGTACAGAATGTATTGCCAAGTACAACTTCCACGGCACTG
CCGAGCAGGACCTGCCCTTCTGCAAAGGAGACGTGCTCACCATTGTGGCCGTCACCAAGGACCCCAACTG
GTACAAAGCCAAAAACAAGGTGGGCCGTGAGGGCATCATCCCAGCCAACTACGTCCAGAAGCGGGAGGGC
GTGAAGGCGGGTACCAAACTCAGCCTCATGCCTTGGTTCCACGGCAAGATCACACGGGAGCAGGCTGAGC
GGCTTCTGTACCCGCCGGAGACAGGCCTGTTCCTGGTGCGGGAGAGCACCAACTACCCCGGAGACTACAC
GCTGTGCGTGAGCTGCGACGGCAAGGTGGAGCACTACCGCATCATGTACCATGCCAGCAAGCTCAGCATC
GACGAGGAGGTGTACTTTGAGAACCTCATGCAGCTGGTGGAGCACTACACCTCAGACGCAGATGGACTCT
GTACGCGCCTCATTAAACCAAAGGTCATGGAGGGCACAGTGGCGGCCCAGGATGAGTTCTACCGCAGCGG
CTGGGCCCTGAACATGAAGGAGCTGAAGCTGCTGCAGACCATCGGGAAGGGGGAGTTCGGAGACGTGATG
CTGGGCGATTACCGAGGGAACAAAGTCGCCGTCAAGTGCATTAAGAACGACGCCACTGCCCAGGCCTTCC
TGGCTGAAGCCTCAGTCATGACGCAACTGCGGCATAGCAACCTGGTGCAGCTCCTGGGCGTGATCGTGGA
GGAGAAGGGCGGGCTCTACATCGTCACTGAGTACATGGCCAAGGGGAGCCTTGTGGACTACCTGCGGTCT
AGGGGTCGGTCAGTGCTGGGCGGAGACTGTCTCCTCAAGTTCTCGCTAGATGTCTGCGAGGCCATGGAAT
ACCTGGAGGGCAACAATTTCGTGCATCGAGACCTGGCTGCCCGCAATGTGCTGGTGTCTGAGGACAACGT
GGCCAAGGTCAGCGACTTTGGTCTCACCAAGGAGGCGTCCAGCACCCAGGACACGGGCAAGCTGCCAGTC
AAGTGGACAGCCCCTGAGGCCCTGAGAGAGAAGAAATTCTCCACTAAGTCTGACGTGTGGAGTTTCGGAA
TCCTTCTCTGGGAAATCTACTCCTTTGGGCGAGTGCCTTATCCAAGAATTCCCCTGAAGGACGTCGTCCC
TCGGGTGGAGAAGGGCTACAAGATGGATGCCCCCGACGGCTGCCCGCCCGCAGTCTATGAAGTCATGAAG
AACTGCTGGCACCTGGACGCCGCCATGCGGCCCTCCTTCCTACAGCTCCGAGAGCAGCTTGAGCACATCA
AAACCCACGAGCTGCACCTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC210758 protein sequence
Red=Cloning site Green=Tags(s)

MSAIQAAWPSGTECIAKYNFHGTAEQDLPFCKGDVLTIVAVTKDPNWYKAKNKVGREGIIPANYVQKREG
VKAGTKLSLMPWFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCVSCDGKVEHYRIMYHASKLSI
DEEVYFENLMQLVEHYTSDADGLCTRLIKPKVMEGTVAAQDEFYRSGWALNMKELKLLQTIGKGEFGDVM
LGDYRGNKVAVKCIKNDATAQAFLAEASVMTQLRHSNLVQLLGVIVEEKGGLYIVTEYMAKGSLVDYLRS
RGRSVLGGDCLLKFSLDVCEAMEYLEGNNFVHRDLAARNVLVSEDNVAKVSDFGLTKEASSTQDTGKLPV
KWTAPEALREKKFSTKSDVWSFGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPPAVYEVMK
NCWHLDAAMRPSFLQLREQLEHIKTHELHL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_004383
ORF Size 1350 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_004383.2
RefSeq Size 2755 bp
RefSeq ORF 1353 bp
Locus ID 1445
UniProt ID P41240
Cytogenetics 15q24.1
Domains pkinase, SH2, TyrKc, SH3, S_TKc
Protein Families Druggable Genome, Protein Kinase
Protein Pathways Chemokine signaling pathway, Epithelial cell signaling in Helicobacter pylori infection, Neurotrophin signaling pathway, Regulation of actin cytoskeleton
MW 50.7 kDa
Gene Summary The protein encoded by this gene is involved in multiple pathways, including the regulation of Src family kinases. It plays an important role in T-cell activation through its association with the protein encoded by the protein tyrosine phosphatase, non-receptor type 22 (PTPN22) gene. This protein also phosphorylates C-terminal tyrosine residues on multiple substrates, including the protein encoded by the SRC proto-oncogene, non-receptor tyrosine kinase gene. Phosphorylation suppresses the kinase activity of the Src family tyrosine kinases. An intronic polymorphism (rs34933034) in this gene has been found to affect B-cell activation and is associated with systemic lupus erythematosus (SLE). Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2017]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.