CSK (NM_004383) Human Tagged ORF Clone

CAT#: RC210758

CSK (Myc-DDK-tagged)-Human c-src tyrosine kinase (CSK), transcript variant 1

Change vector?

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name CSK (NM_004383) Human Tagged ORF Clone
Symbol CSK
Synonyms MGC117393
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC210758 representing NM_004383
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCAGCAATACAGGCCGCCTGGCCATCCGGTACAGAATGTATTGCCAAGTACAACTTCCACGGCACTG
CCGAGCAGGACCTGCCCTTCTGCAAAGGAGACGTGCTCACCATTGTGGCCGTCACCAAGGACCCCAACTG
GTACAAAGCCAAAAACAAGGTGGGCCGTGAGGGCATCATCCCAGCCAACTACGTCCAGAAGCGGGAGGGC
GTGAAGGCGGGTACCAAACTCAGCCTCATGCCTTGGTTCCACGGCAAGATCACACGGGAGCAGGCTGAGC
GGCTTCTGTACCCGCCGGAGACAGGCCTGTTCCTGGTGCGGGAGAGCACCAACTACCCCGGAGACTACAC
GCTGTGCGTGAGCTGCGACGGCAAGGTGGAGCACTACCGCATCATGTACCATGCCAGCAAGCTCAGCATC
GACGAGGAGGTGTACTTTGAGAACCTCATGCAGCTGGTGGAGCACTACACCTCAGACGCAGATGGACTCT
GTACGCGCCTCATTAAACCAAAGGTCATGGAGGGCACAGTGGCGGCCCAGGATGAGTTCTACCGCAGCGG
CTGGGCCCTGAACATGAAGGAGCTGAAGCTGCTGCAGACCATCGGGAAGGGGGAGTTCGGAGACGTGATG
CTGGGCGATTACCGAGGGAACAAAGTCGCCGTCAAGTGCATTAAGAACGACGCCACTGCCCAGGCCTTCC
TGGCTGAAGCCTCAGTCATGACGCAACTGCGGCATAGCAACCTGGTGCAGCTCCTGGGCGTGATCGTGGA
GGAGAAGGGCGGGCTCTACATCGTCACTGAGTACATGGCCAAGGGGAGCCTTGTGGACTACCTGCGGTCT
AGGGGTCGGTCAGTGCTGGGCGGAGACTGTCTCCTCAAGTTCTCGCTAGATGTCTGCGAGGCCATGGAAT
ACCTGGAGGGCAACAATTTCGTGCATCGAGACCTGGCTGCCCGCAATGTGCTGGTGTCTGAGGACAACGT
GGCCAAGGTCAGCGACTTTGGTCTCACCAAGGAGGCGTCCAGCACCCAGGACACGGGCAAGCTGCCAGTC
AAGTGGACAGCCCCTGAGGCCCTGAGAGAGAAGAAATTCTCCACTAAGTCTGACGTGTGGAGTTTCGGAA
TCCTTCTCTGGGAAATCTACTCCTTTGGGCGAGTGCCTTATCCAAGAATTCCCCTGAAGGACGTCGTCCC
TCGGGTGGAGAAGGGCTACAAGATGGATGCCCCCGACGGCTGCCCGCCCGCAGTCTATGAAGTCATGAAG
AACTGCTGGCACCTGGACGCCGCCATGCGGCCCTCCTTCCTACAGCTCCGAGAGCAGCTTGAGCACATCA
AAACCCACGAGCTGCACCTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC210758 representing NM_004383
Red=Cloning site Green=Tags(s)

MSAIQAAWPSGTECIAKYNFHGTAEQDLPFCKGDVLTIVAVTKDPNWYKAKNKVGREGIIPANYVQKREG
VKAGTKLSLMPWFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCVSCDGKVEHYRIMYHASKLSI
DEEVYFENLMQLVEHYTSDADGLCTRLIKPKVMEGTVAAQDEFYRSGWALNMKELKLLQTIGKGEFGDVM
LGDYRGNKVAVKCIKNDATAQAFLAEASVMTQLRHSNLVQLLGVIVEEKGGLYIVTEYMAKGSLVDYLRS
RGRSVLGGDCLLKFSLDVCEAMEYLEGNNFVHRDLAARNVLVSEDNVAKVSDFGLTKEASSTQDTGKLPV
KWTAPEALREKKFSTKSDVWSFGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPPAVYEVMK
NCWHLDAAMRPSFLQLREQLEHIKTHELHL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_004383
ORF Size 1350 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_004383.1, NM_004383.2, NP_004374
RefSeq Size 2420
Locus ID 1445
Cytogenetics 15q24.1
Domains pkinase, SH2, TyrKc, SH3, S_TKc
Protein Families Protein Kinase, Druggable Genome
Protein Pathways Chemokine signaling pathway, Neurotrophin signaling pathway, Regulation of actin cytoskeleton, Epithelial cell signaling in Helicobacter pylori infection
MW 50.5 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.