G protein alpha 12 (GNA12) (NM_007353) Human Tagged ORF Clone

CAT#: RC210511

GNA12 (Myc-DDK-tagged)-Human guanine nucleotide binding protein (G protein) alpha 12 (GNA12)

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro


  "NM_007353" in other vectors (6)

Reconstitution Protocol

USD 686.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


GNA12 rabbit polyclonal antibody
    • 100 ul

USD 380.00

Other products for "G protein alpha 12"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol G protein alpha 12
Synonyms gep; NNX3; RMP
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC210511 representing NM_007353
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCGGGGTGGTGCGGACCCTCAGCCGCTGCCTGCTGCCGGCCGAGGCCGGCGGGGCCCGCGAGCGCA
GGGCGGGCAGCGGCGCGCGCGACGCGGAGCGCGAGGCCCGGAGGCGTAGCCGCGACATCGACGCGCTGCT
GGCCCGCGAGCGGCGCGCGGTCCGGCGCCTGGTGAAGATCCTGCTGCTGGGCGCGGGCGAGAGCGGCAAG
TCCACGTTCCTCAAGCAGATGCGCATCATCCACGGCCGCGAGTTCGACCAGAAGGCGCTGCTGGAGTTCC
GCGACACCATCTTCGACAACATCCTCAAGGGCTCAAGGGTTCTTGTTGATGCACGAGATAAGCTTGGCAT
TCCTTGGCAGTATTCTGAAAATGAGAAGCATGGGATGTTCCTGATGGCCTTCGAGAACAAGGCGGGGCTG
CCTGTGGAGCCGGCCACCTTCCAGCTGTACGTCCCGGCCCTGAGCGCACTCTGGAGGGATTCTGGCATCA
GGGAGGCTTTCAGCCGGAGAAGCGAGTTTCAGCTGGGGGAGTCGGTGAAGTACTTCCTGGACAACTTGGA
CCGGATCGGCCAGCTGAATTACTTTCCTAGTAAGCAAGATATCCTGCTGGCTAGGAAAGCCACCAAGGGA
ATTGTGGAGCATGACTTCGTTATTAAGAAGATCCCCTTTAAGATGGTGGATGTGGGCGGCCAGCGGTCCC
AGCGCCAGAAGTGGTTCCAGTGCTTCGACGGGATCACGTCCATCCTGTTCATGGTCTCCTCCAGCGAGTA
CGACCAGGTCCTCATGGAGGACAGGCGCACCAACCGGCTGGTGGAGTCCATGAACATCTTCGAGACCATC
GTCAACAACAAGCTCTTCTTCAACGTCTCCATCATTCTCTTCCTCAACAAGATGGACCTCCTGGTGGAGA
AGGTGAAGACCGTGAGCATCAAGAAGCACTTCCCGGACTTCAGGGGCGACCCGCACAGGCTGGAGGACGT
CCAGCGCTACCTGGTCCAGTGCTTCGACAGGAAGAGACGGAACCGCAGCAAGCCACTCTTCCACCACTTC
ACCACCGCCATCGACACCGAGAACGTCCGCTTCGTGTTCCATGCTGTGAAAGACACCATCCTGCAGGAGA
ACCTGAAGGACATCATGCTGCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC210511 representing NM_007353
Red=Cloning site Green=Tags(s)

MSGVVRTLSRCLLPAEAGGARERRAGSGARDAEREARRRSRDIDALLARERRAVRRLVKILLLGAGESGK
STFLKQMRIIHGREFDQKALLEFRDTIFDNILKGSRVLVDARDKLGIPWQYSENEKHGMFLMAFENKAGL
PVEPATFQLYVPALSALWRDSGIREAFSRRSEFQLGESVKYFLDNLDRIGQLNYFPSKQDILLARKATKG
IVEHDFVIKKIPFKMVDVGGQRSQRQKWFQCFDGITSILFMVSSSEYDQVLMEDRRTNRLVESMNIFETI
VNNKLFFNVSIILFLNKMDLLVEKVKTVSIKKHFPDFRGDPHRLEDVQRYLVQCFDRKRRNRSKPLFHHF
TTAIDTENVRFVFHAVKDTILQENLKDIMLQ

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_007353
ORF Size 1143 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_007353.3
RefSeq Size 4398 bp
RefSeq ORF 1146 bp
Locus ID 2768
UniProt ID Q03113
Cytogenetics 7p22.3-p22.2
Domains G-alpha
Protein Families Druggable Genome
Protein Pathways Long-term depression, MAPK signaling pathway, Regulation of actin cytoskeleton, Vascular smooth muscle contraction
MW 44.1 kDa
Gene Summary Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems (PubMed:22609986, PubMed:15525651, PubMed:15240885, PubMed:17565996, PubMed:12515866, PubMed:16787920, PubMed:16705036, PubMed:23762476, PubMed:27084452). Activates effector molecule RhoA by binding and activating RhoGEFs (ARHGEF12/LARG) (PubMed:15240885, PubMed:12515866, PubMed:16202387). GNA12-dependent Rho signaling subsequently regulates transcription factor AP-1 (activating protein-1) (By similarity). GNA12-dependent Rho signaling also regulates protein phosphatese 2A activation causing dephosphorylation of its target proteins (PubMed:15525651, PubMed:17565996). Promotes tumor cell invasion and metastasis by activating RhoA/ROCK signaling pathway and up-regulating proinflammatory cytokine production (PubMed:23762476, PubMed:16787920, PubMed:16705036, PubMed:27084452). Inhibits CDH1-mediated cell adhesion in process independent from Rho activation (PubMed:11976333, PubMed:16787920). Together with NAPA promotes CDH5 localization to plasma membrane (PubMed:15980433). May play a role in the control of cell migration through the TOR signaling cascade (PubMed:22609986).[UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.