G protein alpha 12(GNA12) (NM_007353) Human Tagged ORF Clone

CAT#: RC210511

GNA12 (Myc-DDK-tagged)-Human guanine nucleotide binding protein (G protein) alpha 12 (GNA12)

Clone Modification / Custom Cloning Service

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name G protein alpha 12(GNA12) (NM_007353) Human Tagged ORF Clone
Symbol GNA12
Synonyms gep; NNX3; RMP
Vector pCMV6-Entry
Sequence Data
>RC210511 representing NM_007353
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCGGGGTGGTGCGGACCCTCAGCCGCTGCCTGCTGCCGGCCGAGGCCGGCGGGGCCCGCGAGCGCA
GGGCGGGCAGCGGCGCGCGCGACGCGGAGCGCGAGGCCCGGAGGCGTAGCCGCGACATCGACGCGCTGCT
GGCCCGCGAGCGGCGCGCGGTCCGGCGCCTGGTGAAGATCCTGCTGCTGGGCGCGGGCGAGAGCGGCAAG
TCCACGTTCCTCAAGCAGATGCGCATCATCCACGGCCGCGAGTTCGACCAGAAGGCGCTGCTGGAGTTCC
GCGACACCATCTTCGACAACATCCTCAAGGGCTCAAGGGTTCTTGTTGATGCACGAGATAAGCTTGGCAT
TCCTTGGCAGTATTCTGAAAATGAGAAGCATGGGATGTTCCTGATGGCCTTCGAGAACAAGGCGGGGCTG
CCTGTGGAGCCGGCCACCTTCCAGCTGTACGTCCCGGCCCTGAGCGCACTCTGGAGGGATTCTGGCATCA
GGGAGGCTTTCAGCCGGAGAAGCGAGTTTCAGCTGGGGGAGTCGGTGAAGTACTTCCTGGACAACTTGGA
CCGGATCGGCCAGCTGAATTACTTTCCTAGTAAGCAAGATATCCTGCTGGCTAGGAAAGCCACCAAGGGA
ATTGTGGAGCATGACTTCGTTATTAAGAAGATCCCCTTTAAGATGGTGGATGTGGGCGGCCAGCGGTCCC
AGCGCCAGAAGTGGTTCCAGTGCTTCGACGGGATCACGTCCATCCTGTTCATGGTCTCCTCCAGCGAGTA
CGACCAGGTCCTCATGGAGGACAGGCGCACCAACCGGCTGGTGGAGTCCATGAACATCTTCGAGACCATC
GTCAACAACAAGCTCTTCTTCAACGTCTCCATCATTCTCTTCCTCAACAAGATGGACCTCCTGGTGGAGA
AGGTGAAGACCGTGAGCATCAAGAAGCACTTCCCGGACTTCAGGGGCGACCCGCACAGGCTGGAGGACGT
CCAGCGCTACCTGGTCCAGTGCTTCGACAGGAAGAGACGGAACCGCAGCAAGCCACTCTTCCACCACTTC
ACCACCGCCATCGACACCGAGAACGTCCGCTTCGTGTTCCATGCTGTGAAAGACACCATCCTGCAGGAGA
ACCTGAAGGACATCATGCTGCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC210511 representing NM_007353
Red=Cloning site Green=Tags(s)

MSGVVRTLSRCLLPAEAGGARERRAGSGARDAEREARRRSRDIDALLARERRAVRRLVKILLLGAGESGK
STFLKQMRIIHGREFDQKALLEFRDTIFDNILKGSRVLVDARDKLGIPWQYSENEKHGMFLMAFENKAGL
PVEPATFQLYVPALSALWRDSGIREAFSRRSEFQLGESVKYFLDNLDRIGQLNYFPSKQDILLARKATKG
IVEHDFVIKKIPFKMVDVGGQRSQRQKWFQCFDGITSILFMVSSSEYDQVLMEDRRTNRLVESMNIFETI
VNNKLFFNVSIILFLNKMDLLVEKVKTVSIKKHFPDFRGDPHRLEDVQRYLVQCFDRKRRNRSKPLFHHF
TTAIDTENVRFVFHAVKDTILQENLKDIMLQ

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_007353
ORF Size 1143 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_007353.1, NM_007353.2, NP_031379
RefSeq Size 4398
RefSeq ORF 1146
Locus ID 2768
Cytogenetics 7p22.3-p22.2
Domains G-alpha
Protein Families Druggable Genome
Protein Pathways MAPK signaling pathway, Vascular smooth muscle contraction, Long-term depression, Regulation of actin cytoskeleton
MW 44.1 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)