GRPR (NM_005314) Human Tagged ORF Clone

CAT#: RC210362

GRPR (Myc-DDK-tagged)-Human gastrin-releasing peptide receptor (GRPR)

Change vector?

USD 577


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name GRPR (NM_005314) Human Tagged ORF Clone
Symbol GRPR
Synonyms BB2; BB2R
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC210362 representing NM_005314
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTCTAAATGACTGTTTCCTTCTGAACTTGGAGGTGGACCATTTCATGCACTGCAACATCTCCAGTC
ACAGTGCGGATCTCCCCGTGAACGATGACTGGTCCCACCCGGGGATCCTCTATGTCATCCCTGCAGTTTA
TGGGGTTATCATTCTGATAGGCCTCATTGGCAACATCACTTTGATCAAGATCTTCTGTACAGTCAAGTCC
ATGCGAAACGTTCCAAACCTGTTCATTTCCAGTCTGGCTTTGGGAGACCTGCTCCTCCTAATAACGTGTG
CTCCAGTGGATGCCAGCAGGTACCTGGCTGACAGATGGCTATTTGGCAGGATTGGCTGCAAACTGATCCC
CTTTATACAGCTTACCTCTGTTGGGGTGTCTGTCTTCACACTCACGGCGCTCTCGGCAGACAGATACAAA
GCCATTGTCCGGCCAATGGATATCCAGGCCTCCCATGCCCTGATGAAGATCTGCCTCAAAGCCGCCTTTA
TCTGGATCATCTCCATGCTGCTGGCCATTCCAGAGGCCGTGTTTTCTGACCTCCATCCCTTCCATGAGGA
AAGCACCAACCAGACCTTCATTAGCTGTGCCCCATACCCACACTCTAATGAGCTTCACCCCAAAATCCAT
TCTATGGCTTCCTTTCTGGTCTTCTACGTCATCCCACTGTCGATCATCTCTGTTTACTACTACTTCATTG
CTAAAAATCTGATCCAGAGTGCTTACAATCTTCCCGTGGAAGGGAATATACATGTCAAGAAGCAGATTGA
ATCCCGGAAGCGACTTGCCAAGACAGTGCTGGTGTTTGTGGGCCTGTTCGCCTTCTGCTGGCTCCCCAAT
CATGTCATCTACCTGTACCGCTCCTACCACTACTCTGAGGTGGACACCTCCATGCTCCACTTTGTCACCA
GCATCTGTGCCCGCCTCCTGGCCTTCACCAACTCCTGCGTGAACCCCTTTGCCCTCTACCTGCTGAGCAA
GAGTTTCAGGAAACAGTTCAACACTCAGCTGCTCTGTTGCCAGCCTGGCCTGATCATCCGGTCTCACAGC
ACTGGAAGGAGTACAACCTGCATGACCTCCCTCAAGAGTACCAACCCCTCCGTGGCCACCTTTAGCCTCA
TCAATGGAAACATCTGTCACGAGCGGTATGTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC210362 representing NM_005314
Red=Cloning site Green=Tags(s)

MALNDCFLLNLEVDHFMHCNISSHSADLPVNDDWSHPGILYVIPAVYGVIILIGLIGNITLIKIFCTVKS
MRNVPNLFISSLALGDLLLLITCAPVDASRYLADRWLFGRIGCKLIPFIQLTSVGVSVFTLTALSADRYK
AIVRPMDIQASHALMKICLKAAFIWIISMLLAIPEAVFSDLHPFHEESTNQTFISCAPYPHSNELHPKIH
SMASFLVFYVIPLSIISVYYYFIAKNLIQSAYNLPVEGNIHVKKQIESRKRLAKTVLVFVGLFAFCWLPN
HVIYLYRSYHYSEVDTSMLHFVTSICARLLAFTNSCVNPFALYLLSKSFRKQFNTQLLCCQPGLIIRSHS
TGRSTTCMTSLKSTNPSVATFSLINGNICHERYV

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_005314
ORF Size 1152 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_005314.1, NM_005314.2, NP_005305
RefSeq Size 2681
RefSeq ORF 1155
Locus ID 2925
Cytogenetics Xp22.2
Protein Families GPCR, Transmembrane, Druggable Genome
Protein Pathways Calcium signaling pathway, Neuroactive ligand-receptor interaction
MW 43 kDa
Gene Summary Gastrin-releasing peptide (GRP) regulates numerous functions of the gastrointestinal and central nervous systems, including release of gastrointestinal hormones, smooth muscle cell contraction, and epithelial cell proliferation and is a potent mitogen for neoplastic tissues. The effects of GRP are mediated through the gastrin-releasing peptide receptor. This receptor is a glycosylated, 7-transmembrane G-protein coupled receptor that activates the phospholipase C signaling pathway. The receptor is aberrantly expressed in numerous cancers such as those of the lung, colon, and prostate. An individual with autism and multiple exostoses was found to have a balanced translocation between chromosome 8 and a chromosome X breakpoint located within the gastrin-releasing peptide receptor gene. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations