VPS37A (NM_152415) Human Tagged ORF Clone

CAT#: RC209716

VPS37A (Myc-DDK-tagged)-Human vacuolar protein sorting 37 homolog A (S. cerevisiae) (VPS37A), transcript variant 1

Clone Modification / Custom Cloning Service

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name VPS37A (NM_152415) Human Tagged ORF Clone
Symbol VPS37A
Synonyms HCRP1; PQBP2; SPG53
Vector pCMV6-Entry
Sequence Data
>RC209716 representing NM_152415
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGCTGGCTTTTTCCCCTGACCAAGAGCGCCTCCTCCTCCGCGGCTGGGTCCCCCGGTGGCCTCACCA
GCCTCCAGCAGCAGAAGCAGCGCCTGATCGAGTCCCTCCGGAACTCACACTCCAGTATAGCCGAAATACA
GAAAGATGTGGAATACAGATTGCCATTCACCATAAACAACCTGACAATTAACATTAATATACTGCTTCCT
CCACAGTTTCCTCAGGAAAAACCAGTGATCAGTGTTTATCCACCAATACGACATCACTTAATGGATAAAC
AAGGAGTGTATGTTACCTCTCCATTAGTAAACAATTTTACAATGCACTCAGATCTTGGAAAAATTATTCA
GAGTCTGTTGGATGAGTTTTGGAAGAATCCTCCAGTTTTAGCTCCTACTTCAACAGCATTTCCTTATCTA
TACAGTAACCCAAGTGGGATGTCTCCTTATGCTTCTCAGGGTTTTCCATTTCTTCCTCCATATCCTCCAC
AAGAAGCAAACAGGAGTATCACTTCTTTATCTGTTGCTGACACTGTTTCTTCTTCAACAACAAGTCATAC
CACAGCCAAGCCTGCCGCTCCTTCATTTGGTGTCCTTTCAAATCTGCCATTACCCATTCCCACAGTGGAT
GCTTCAATACCGACAAGCCAAAATGGTTTTGGGTACAAGATGCCAGATGTCCCTGATGCATTTCCAGAAC
TCTCAGAACTAAGTGTGTCACAACTCACAGATATGAATGAACAAGAGGAGGTATTACTAGAACAGTTTCT
GACTTTGCCTCAACTAAAACAAATTATTACCGACAAAGATGACTTAGTAAAAAGTATTGAGGAACTAGCA
AGAAAAAATCTCCTTTTGGAGCCCAGCTTGGAAGCCAAAAGACAAACTGTTTTAGATAAGTATGAATTAC
TTACACAGATGAAGTCCACTTTCGAAAAGAAGATGCAAAGGCAGCATGAACTTAGTGAGATCTGTAGTGC
AAGTGCCCTTCAGGCAAGATTGAAAGTAGCTGCACATGAAGCTGAGGAAGAATCTGATAATATTGCAGAA
GATTTCTTGGAGGGAAAGATGGAAATAGATGATTTTCTCAGTAGCTTCATGGAAAAGAGAACAATTTGCC
ACTGTAGAAGAGCCAAGGAAGAGAAACTTCAGCAGGCGATAGCAATGCACAGCCAATTTCATGCTCCACT
A


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC209716 representing NM_152415
Red=Cloning site Green=Tags(s)

MSWLFPLTKSASSSAAGSPGGLTSLQQQKQRLIESLRNSHSSIAEIQKDVEYRLPFTINNLTININILLP
PQFPQEKPVISVYPPIRHHLMDKQGVYVTSPLVNNFTMHSDLGKIIQSLLDEFWKNPPVLAPTSTAFPYL
YSNPSGMSPYASQGFPFLPPYPPQEANRSITSLSVADTVSSSTTSHTTAKPAAPSFGVLSNLPLPIPTVD
ASIPTSQNGFGYKMPDVPDAFPELSELSVSQLTDMNEQEEVLLEQFLTLPQLKQIITDKDDLVKSIEELA
RKNLLLEPSLEAKRQTVLDKYELLTQMKSTFEKKMQRQHELSEICSASALQARLKVAAHEAEEESDNIAE
DFLEGKMEIDDFLSSFMEKRTICHCRRAKEEKLQQAIAMHSQFHAPL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_152415
ORF Size 1191 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_152415.1, NM_152415.2, NP_689628
RefSeq Size 2020
RefSeq ORF 1194
Locus ID 137492
Cytogenetics 8p22
Protein Pathways Endocytosis
MW 44.1 kDa
Gene Summary This gene belongs to the VPS37 family, and encodes a component of the ESCRT-I (endosomal sorting complex required for transport I) protein complex, required for the sorting of ubiquitinated transmembrane proteins into internal vesicles of multivesicular bodies. Expression of this gene is downregulated in hepatocellular carcinoma, and mutations in this gene are associated with autosomal recessive spastic paraplegia-53. A related pseudogene has been identified on chromosome 5. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Dec 2012].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (2)