HRPT2(CDC73) (NM_024529) Human Tagged ORF Clone

CAT#: RC209479

CDC73 (Myc-DDK-tagged)-Human cell division cycle 73, Paf1/RNA polymerase II complex component, homolog (S. cerevisiae) (CDC73)

Need custom modification / cloning service?
Get a free quote

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name HRPT2(CDC73) (NM_024529) Human Tagged ORF Clone
Symbol CDC73
Synonyms C1orf28; FIHP; HPTJT; HRPT1; HRPT2; HYX
Vector pCMV6-Entry
Sequence Data
>RC209479 representing NM_024529
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGACGTGCTTAGCGTCCTGCGACAGTACAACATCCAGAAGAAGGAGATTGTGGTGAAGGGAGACG
AAGTGATCTTCGGGGAGTTCTCCTGGCCCAAGAATGTGAAGACCAACTATGTTGTTTGGGGGACTGGAAA
GGAAGGCCAACCCAGAGAGTACTACACATTGGATTCCATTTTATTTCTACTTAATAACGTGCACCTTTCT
CATCCTGTTTATGTCCGACGTGCAGCTACTGAAAATATTCCTGTGGTTAGAAGACCTGATCGAAAAGATC
TACTTGGATATCTCAATGGTGAAGCGTCAACATCGGCAAGTATAGACAGAAGCGCTCCCTTAGAAATAGG
TCTTCAGCGATCTACTCAAGTCAAACGAGCTGCAGATGAAGTTTTAGCAGAAGCAAAGAAACCACGAATT
GAGGATGAAGAGTGTGTGCGCCTTGATAAAGAGAGATTGGCTGCCCGTTTGGAGGGTCACAAAGAAGGGA
TTGTACAGACTGAACAGATTAGGTCTTTGTCTGAAGCTATGTCAGTGGAAAAAATTGCTGCAATCAAAGC
CAAAATTATGGCTAAGAAAAGATCTACTATCAAGACTGATCTAGATGATGACATAACTGCCCTTAAACAG
AGGAGTTTTGTGGATGCTGAGGTAGATGTGACCCGAGATATTGTCAGCAGAGAGAGAGTATGGAGGACAC
GAACAACTATCTTACAAAGCACAGGAAAGAATTTTTCCAAGAACATTTTTGCAATTCTTCAATCTGTAAA
AGCCAGAGAAGAAGGGCGTGCACCTGAACAGCGACCTGCCCCAAATGCAGCACCTGTGGATCCCACTTTG
CGCACCAAACAGCCTATCCCAGCTGCCTATAACAGATACGATCAGGAAAGATTCAAAGGAAAAGAAGAAA
CGGAAGGCTTCAAAATTGACACTATGGGAACCTACCATGGTATGACACTGAAATCTGTAACGGAGGGTGC
ATCTGCCCGGAAGACTCAGACTCCTGCAGCCCAGCCAGTACCAAGACCAGTTTCTCAAGCAAGACCTCCC
CCAAATCAGAAGAAAGGATCTCGAACACCCATTATCATAATTCCTGCAGCTACCACCTCTTTAATAACCA
TGCTTAATGCAAAAGACCTTCTACAGGACCTGAAATTTGTCCCATCAGATGAAAAGAAGAAACAAGGTTG
TCAACGAGAAAATGAAACTCTAATACAAAGAAGAAAAGACCAGATGCAACCAGGGGGCACTGCAATTAGT
GTTACAGTACCTTATAGAGTAGTAGACCAGCCCCTTAAACTTATGCCTCAAGACTGGGACCGCGTTGTAG
CCGTTTTTGTGCAGGGTCCTGCATGGCAGTTCAAAGGTTGGCCATGGCTTTTGCCTGATGGATCACCAGT
TGATATATTTGCTAAAATTAAAGCCTTCCATCTGAAGTATGATGAAGTTCGTCTGGATCCAAATGTTCAG
AAATGGGATGTAACAGTATTAGAACTCAGCTATCACAAACGTCATTTGGATAGACCAGTGTTCTTACGGT
TTTGGGAAACATTGGACAGGTACATGGTAAAGCATAAATCGCACTTGAGATTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC209479 representing NM_024529
Red=Cloning site Green=Tags(s)

MADVLSVLRQYNIQKKEIVVKGDEVIFGEFSWPKNVKTNYVVWGTGKEGQPREYYTLDSILFLLNNVHLS
HPVYVRRAATENIPVVRRPDRKDLLGYLNGEASTSASIDRSAPLEIGLQRSTQVKRAADEVLAEAKKPRI
EDEECVRLDKERLAARLEGHKEGIVQTEQIRSLSEAMSVEKIAAIKAKIMAKKRSTIKTDLDDDITALKQ
RSFVDAEVDVTRDIVSRERVWRTRTTILQSTGKNFSKNIFAILQSVKAREEGRAPEQRPAPNAAPVDPTL
RTKQPIPAAYNRYDQERFKGKEETEGFKIDTMGTYHGMTLKSVTEGASARKTQTPAAQPVPRPVSQARPP
PNQKKGSRTPIIIIPAATTSLITMLNAKDLLQDLKFVPSDEKKKQGCQRENETLIQRRKDQMQPGGTAIS
VTVPYRVVDQPLKLMPQDWDRVVAVFVQGPAWQFKGWPWLLPDGSPVDIFAKIKAFHLKYDEVRLDPNVQ
KWDVTVLELSYHKRHLDRPVFLRFWETLDRYMVKHKSHLRF

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_024529
ORF Size 1593 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_024529.2, NM_024529.3, NM_024529.4, NP_078805
RefSeq Size 2980
RefSeq ORF 1596
Locus ID 79577
Cytogenetics 1q31.2
Domains Cdc73
Protein Families Druggable Genome
MW 60.4 kDa
Gene Summary This gene encodes a tumor suppressor that is involved in transcriptional and post-transcriptional control pathways. The protein is a component of the the PAF protein complex, which associates with the RNA polymerase II subunit POLR2A and with a histone methyltransferase complex. This protein appears to facilitate the association of 3' mRNA processing factors with actively-transcribed chromatin. Mutations in this gene have been linked to hyperparathyroidism-jaw tumor syndrome, familial isolated hyperparathyroidism, and parathyroid carcinoma. [provided by RefSeq, Jul 2009]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)