UNG (NM_003362) Human Tagged ORF Clone

CAT#: RC208667

UNG (Myc-DDK-tagged)-Human uracil-DNA glycosylase (UNG), nuclear gene encoding mitochondrial protein, transcript variant 1

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro

AAV Particle: DDK


  "NM_003362" in other vectors (4)

Reconstitution Protocol

USD 300.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


UNG mouse monoclonal antibody, clone OTI2C12 (formerly 2C12)
    • 100 ul

USD 447.00

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol UNG
Synonyms DGU; HIGM4; HIGM5; UDG; UNG1; UNG2; UNG15
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC208667 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCGTCTTCTGCCTTGGGCCGTGGGGGTTGGGCCGGAAGCTGCGGACGCCTGGGAAGGGGCCGCTGC
AGCTCTTGAGCCGCCTCTGCGGGGACCACTTGCAGGCCATCCCAGCCAAGAAGGCCCCGGCTGGGCAGGA
GGAGCCTGGGACGCCGCCCTCCTCGCCGCTGAGTGCCGAGCAGTTGGACCGGATCCAGAGGAACAAGGCC
GCGGCCCTGCTCAGACTCGCGGCCCGCAACGTGCCCGTGGGCTTTGGAGAGAGCTGGAAGAAGCACCTCA
GCGGGGAGTTCGGGAAACCGTATTTTATCAAGCTAATGGGATTTGTTGCAGAAGAAAGAAAGCATTACAC
TGTTTATCCACCCCCACACCAAGTCTTCACCTGGACCCAGATGTGTGACATAAAAGATGTGAAGGTTGTC
ATCCTGGGACAGGATCCATATCATGGACCTAATCAAGCTCACGGGCTCTGCTTTAGTGTTCAAAGGCCTG
TTCCGCCTCCGCCCAGTTTGGAGAACATTTATAAAGAGTTGTCTACAGACATAGAGGATTTTGTTCATCC
TGGCCATGGAGATTTATCTGGGTGGGCCAAGCAAGGTGTTCTCCTTCTCAACGCTGTCCTCACGGTTCGT
GCCCATCAAGCCAACTCTCATAAGGAGCGAGGCTGGGAGCAGTTCACTGATGCAGTTGTGTCCTGGCTAA
ATCAGAACTCGAATGGCCTTGTTTTCTTGCTCTGGGGCTCTTATGCTCAGAAGAAGGGCAGTGCCATTGA
TAGGAAGCGGCACCATGTACTACAGACGGCTCATCCCTCCCCTTTGTCAGTGTATAGAGGGTTCTTTGGA
TGTAGACACTTTTCAAAGACCAATGAGCTGCTGCAGAAGTCTGGCAAGAAGCCCATTGACTGGAAGGAGC
TG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC208667 protein sequence
Red=Cloning site Green=Tags(s)

MGVFCLGPWGLGRKLRTPGKGPLQLLSRLCGDHLQAIPAKKAPAGQEEPGTPPSSPLSAEQLDRIQRNKA
AALLRLAARNVPVGFGESWKKHLSGEFGKPYFIKLMGFVAEERKHYTVYPPPHQVFTWTQMCDIKDVKVV
ILGQDPYHGPNQAHGLCFSVQRPVPPPPSLENIYKELSTDIEDFVHPGHGDLSGWAKQGVLLLNAVLTVR
AHQANSHKERGWEQFTDAVVSWLNQNSNGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPLSVYRGFFG
CRHFSKTNELLQKSGKKPIDWKEL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_003362
ORF Size 912 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_003362.4
RefSeq Size 2166 bp
RefSeq ORF 915 bp
Locus ID 7374
UniProt ID P13051
Cytogenetics 12q24.11
Domains UDG
Protein Families Druggable Genome, Stem cell - Pluripotency
Protein Pathways Base excision repair, Primary immunodeficiency
MW 33.9 kDa
Gene Summary This gene encodes one of several uracil-DNA glycosylases. One important function of uracil-DNA glycosylases is to prevent mutagenesis by eliminating uracil from DNA molecules by cleaving the N-glycosylic bond and initiating the base-excision repair (BER) pathway. Uracil bases occur from cytosine deamination or misincorporation of dUMP residues. Alternative promoter usage and splicing of this gene leads to two different isoforms: the mitochondrial UNG1 and the nuclear UNG2. The UNG2 term was used as a previous symbol for the CCNO gene (GeneID 10309), which has been confused with this gene, in the literature and some databases. [provided by RefSeq, Nov 2010]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.