Cytochrome p450 2J2(CYP2J2) (NM_000775) Human Tagged ORF Clone

CAT#: RC207417

CYP2J2 (Myc-DDK-tagged)-Human cytochrome P450, family 2, subfamily J, polypeptide 2 (CYP2J2)

Need custom modification / cloning service?
Get a free quote

USD 639.00


Availability*
In Stock

Size
    • 10 ug

Cited in 2 publications.

Product images

Specifications

Product Data
Product Name Cytochrome p450 2J2(CYP2J2) (NM_000775) Human Tagged ORF Clone
Symbol CYP2J2
Synonyms CPJ2
Vector pCMV6-Entry
Sequence Data
>RC207417 representing NM_000775
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTCGCGGCGATGGGCTCTCTGGCGGCTGCCCTCTGGGCAGTGGTCCATCCTCGGACTCTCCTACTGG
GCACTGTCGCCTTTCTGCTCGCTGCTGACTTTCTCAAAAGACGGCGCCCAAAGAACTACCCGCCGGGGCC
CTGGCGCCTGCCCTTCCTTGGCAACTTCTTCCTTGTGGACTTCGAGCAGTCGCACCTGGAGGTTCAGCTG
TTTGTGAAGAAATATGGGAACCTTTTTAGCTTGGAGCTTGGTGACATATCTGCAGTTCTTATTACTGGCT
TGCCCTTAATCAAAGAAGCCCTTATCCACATGGACCAAAACTTTGGGAACCGCCCCGTGACCCCTATGCG
AGAACATATCTTTAAGAAAAATGGATTGATTATGTCAAGTGGCCAGGCATGGAAGGAGCAAAGAAGGTTC
ACTCTGACAGCACTAAGGAACTTTGGTTTAGGAAAGAAGAGCTTAGAGGAACGCATTCAGGAGGAGGCCC
AACACCTCACTGAAGCAATAAAAGAGGAGAACGGACAGCCTTTTGACCCTCATTTCAAGATCAACAATGC
AGTTTCCAATATCATTTGCTCCATCACCTTCGGAGAACGCTTTGAGTACCAGGATAGTTGGTTTCAGCAG
CTGCTGAAGTTACTAGATGAAGTCACATACTTGGAGGCTTCAAAGACATGCCAGCTCTACAATGTCTTTC
CATGGATAATGAAATTCCTGCCTGGACCCCACCAAACTCTCTTCAGCAACTGGAAAAAACTGAAATTGTT
TGTTTCTCATATGATTGACAAACACAGAAAGGATTGGAATCCTGCAGAAACAAGAGACTTTATTGATGCT
TACCTTAAAGAAATGTCAAAGCACACAGGCAATCCTACTTCAAGTTTCCATGAAGAAAACCTCATCTGCA
GCACCCTGGACCTCTTCTTTGCCGGAACCGAGACAACTTCCACAACTCTGCGATGGGCTCTGCTTTATAT
GGCCCTCTACCCAGAAATCCAAGAAAAAGTACAAGCTGAGATTGACAGAGTGATTGGCCAGGGGCAGCAG
CCGAGCACAGCCGCCCGGGAGTCCATGCCCTACACCAATGCTGTCATCCATGAGGTGCAGAGAATGGGCA
ACATCATCCCCCTGAACGTTCCCAGGGAAGTGACAGTTGATACCACTTTGGCTGGGTACCACCTGCCCAA
GGGTACCATGATCCTGACCAATTTGACGGCGCTGCACAGGGACCCCACAGAGTGGGCCACCCCTGACACA
TTCAATCCGGACCATTTTCTGGAGAATGGACAGTTTAAGAAAAGGGAAGCCTTTATGCCTTTCTCAATAG
GAAAGCGGGCATGCCTCGGAGAACAGTTGGCCAGGACTGAGCTGTTTATTTTCTTCACTTCCCTTATGCA
AAAATTTACCTTCAGGCCCCCAAACAATGAGAAGCTGAGCCTGAAGTTTAGAATGGGTATCACCATTTCC
CCAGTCAGTCACCGCCTCTGCGCTGTTCCTCAGGTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC207417 representing NM_000775
Red=Cloning site Green=Tags(s)

MLAAMGSLAAALWAVVHPRTLLLGTVAFLLAADFLKRRRPKNYPPGPWRLPFLGNFFLVDFEQSHLEVQL
FVKKYGNLFSLELGDISAVLITGLPLIKEALIHMDQNFGNRPVTPMREHIFKKNGLIMSSGQAWKEQRRF
TLTALRNFGLGKKSLEERIQEEAQHLTEAIKEENGQPFDPHFKINNAVSNIICSITFGERFEYQDSWFQQ
LLKLLDEVTYLEASKTCQLYNVFPWIMKFLPGPHQTLFSNWKKLKLFVSHMIDKHRKDWNPAETRDFIDA
YLKEMSKHTGNPTSSFHEENLICSTLDLFFAGTETTSTTLRWALLYMALYPEIQEKVQAEIDRVIGQGQQ
PSTAARESMPYTNAVIHEVQRMGNIIPLNVPREVTVDTTLAGYHLPKGTMILTNLTALHRDPTEWATPDT
FNPDHFLENGQFKKREAFMPFSIGKRACLGEQLARTELFIFFTSLMQKFTFRPPNNEKLSLKFRMGITIS
PVSHRLCAVPQV

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_000775
ORF Size 1506 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_000775.1, NM_000775.2, NM_000775.3, NP_000766
RefSeq Size 1876
RefSeq ORF 1509
Locus ID 1573
Cytogenetics 1p32.1
Domains p450
Protein Families Transmembrane, P450, Druggable Genome
Protein Pathways Arachidonic acid metabolism, Linoleic acid metabolism, Metabolic pathways
MW 57.4 kDa
Gene Summary This enzyme metabolizes arachidonic acid predominantly via a NADPH-dependent olefin epoxidation to all four regioisomeric cis-epoxyeicosatrienoic acids. One of the predominant enzymes responsible for the epoxidation of endogenous cardiac arachidonic acid pools. [UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (2)