Cytochrome p450 2J2 (CYP2J2) (NM_000775) Human Tagged ORF Clone

CAT#: RC207417

Reviews ()
Write a review

CYP2J2 (Myc-DDK-tagged)-Human cytochrome P450, family 2, subfamily J, polypeptide 2 (CYP2J2)



  "NM_000775" in other vectors (4)

Get anti-DDK tag antibody at $68 with code “DDK”. View details.

USD 474.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name Cytochrome p450 2J2 (CYP2J2) (NM_000775) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol CYP2J2
Synonyms CPJ2; CYPIIJ2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC207417 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTCGCGGCGATGGGCTCTCTGGCGGCTGCCCTCTGGGCAGTGGTCCATCCTCGGACTCTCCTACTGG
GCACTGTCGCCTTTCTGCTCGCTGCTGACTTTCTCAAAAGACGGCGCCCAAAGAACTACCCGCCGGGGCC
CTGGCGCCTGCCCTTCCTTGGCAACTTCTTCCTTGTGGACTTCGAGCAGTCGCACCTGGAGGTTCAGCTG
TTTGTGAAGAAATATGGGAACCTTTTTAGCTTGGAGCTTGGTGACATATCTGCAGTTCTTATTACTGGCT
TGCCCTTAATCAAAGAAGCCCTTATCCACATGGACCAAAACTTTGGGAACCGCCCCGTGACCCCTATGCG
AGAACATATCTTTAAGAAAAATGGATTGATTATGTCAAGTGGCCAGGCATGGAAGGAGCAAAGAAGGTTC
ACTCTGACAGCACTAAGGAACTTTGGTTTAGGAAAGAAGAGCTTAGAGGAACGCATTCAGGAGGAGGCCC
AACACCTCACTGAAGCAATAAAAGAGGAGAACGGACAGCCTTTTGACCCTCATTTCAAGATCAACAATGC
AGTTTCCAATATCATTTGCTCCATCACCTTCGGAGAACGCTTTGAGTACCAGGATAGTTGGTTTCAGCAG
CTGCTGAAGTTACTAGATGAAGTCACATACTTGGAGGCTTCAAAGACATGCCAGCTCTACAATGTCTTTC
CATGGATAATGAAATTCCTGCCTGGACCCCACCAAACTCTCTTCAGCAACTGGAAAAAACTGAAATTGTT
TGTTTCTCATATGATTGACAAACACAGAAAGGATTGGAATCCTGCAGAAACAAGAGACTTTATTGATGCT
TACCTTAAAGAAATGTCAAAGCACACAGGCAATCCTACTTCAAGTTTCCATGAAGAAAACCTCATCTGCA
GCACCCTGGACCTCTTCTTTGCCGGAACCGAGACAACTTCCACAACTCTGCGATGGGCTCTGCTTTATAT
GGCCCTCTACCCAGAAATCCAAGAAAAAGTACAAGCTGAGATTGACAGAGTGATTGGCCAGGGGCAGCAG
CCGAGCACAGCCGCCCGGGAGTCCATGCCCTACACCAATGCTGTCATCCATGAGGTGCAGAGAATGGGCA
ACATCATCCCCCTGAACGTTCCCAGGGAAGTGACAGTTGATACCACTTTGGCTGGGTACCACCTGCCCAA
GGGTACCATGATCCTGACCAATTTGACGGCGCTGCACAGGGACCCCACAGAGTGGGCCACCCCTGACACA
TTCAATCCGGACCATTTTCTGGAGAATGGACAGTTTAAGAAAAGGGAAGCCTTTATGCCTTTCTCAATAG
GAAAGCGGGCATGCCTCGGAGAACAGTTGGCCAGGACTGAGCTGTTTATTTTCTTCACTTCCCTTATGCA
AAAATTTACCTTCAGGCCCCCAAACAATGAGAAGCTGAGCCTGAAGTTTAGAATGGGTATCACCATTTCC
CCAGTCAGTCACCGCCTCTGCGCTGTTCCTCAGGTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC207417 protein sequence
Red=Cloning site Green=Tags(s)

MLAAMGSLAAALWAVVHPRTLLLGTVAFLLAADFLKRRRPKNYPPGPWRLPFLGNFFLVDFEQSHLEVQL
FVKKYGNLFSLELGDISAVLITGLPLIKEALIHMDQNFGNRPVTPMREHIFKKNGLIMSSGQAWKEQRRF
TLTALRNFGLGKKSLEERIQEEAQHLTEAIKEENGQPFDPHFKINNAVSNIICSITFGERFEYQDSWFQQ
LLKLLDEVTYLEASKTCQLYNVFPWIMKFLPGPHQTLFSNWKKLKLFVSHMIDKHRKDWNPAETRDFIDA
YLKEMSKHTGNPTSSFHEENLICSTLDLFFAGTETTSTTLRWALLYMALYPEIQEKVQAEIDRVIGQGQQ
PSTAARESMPYTNAVIHEVQRMGNIIPLNVPREVTVDTTLAGYHLPKGTMILTNLTALHRDPTEWATPDT
FNPDHFLENGQFKKREAFMPFSIGKRACLGEQLARTELFIFFTSLMQKFTFRPPNNEKLSLKFRMGITIS
PVSHRLCAVPQV

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_000775
ORF Size 1506 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_000775.4
RefSeq Size 1876 bp
RefSeq ORF 1509 bp
Locus ID 1573
Cytogenetics 1p32.1
Domains p450
Protein Families Druggable Genome, P450, Transmembrane
Protein Pathways Arachidonic acid metabolism, Linoleic acid metabolism, Metabolic pathways
MW 57.6 kDa
Gene Summary This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is thought to be the predominant enzyme responsible for epoxidation of endogenous arachidonic acid in cardiac tissue. Multiple transcript variants have been found for this gene. [provided by RefSeq, Jan 2016]

Other Versions

Other products for "CYP2J2"
Frequently bought together (3)
CYP2J2 (Cytochrome p450 2J2) mouse monoclonal antibody, clone OTI5C5 (formerly 5C5)
    • 100 ul

USD 379.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 150.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Molbio tools