CD8A (NM_001768) Human Tagged ORF Clone
- TrueORF®
CD8A (Myc-DDK-tagged)-Human CD8a molecule (CD8A), transcript variant 1
Specifications
Product Data | |
Product Name | CD8A (NM_001768) Human Tagged ORF Clone |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | CD8A |
Synonyms | CD8; Leu2; p32 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Cell Selection | Neomycin |
Sequence Data |
>RC206608 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCCTTACCAGTGACCGCCTTGCTCCTGCCGCTGGCCTTGCTGCTCCACGCCGCCAGGCCGAGCCAGT TCCGGGTGTCGCCGCTGGATCGGACCTGGAACCTGGGCGAGACAGTGGAGCTGAAGTGCCAGGTGCTGCT GTCCAACCCGACGTCGGGCTGCTCGTGGCTCTTCCAGCCGCGCGGCGCCGCCGCCAGTCCCACCTTCCTC CTATACCTCTCCCAAAACAAGCCCAAGGCGGCCGAGGGGCTGGACACCCAGCGGTTCTCGGGCAAGAGGT TGGGGGACACCTTCGTCCTCACCCTGAGCGACTTCCGCCGAGAGAACGAGGGCTGCTATTTCTGCTCGGC CCTGAGCAACTCCATCATGTACTTCAGCCACTTCGTGCCGGTCTTCCTGCCAGCGAAGCCCACCACGACG CCAGCGCCGCGACCACCAACACCGGCGCCCACCATCGCGTCGCAGCCCCTGTCCCTGCGCCCAGAGGCGT GCCGGCCAGCGGCGGGGGGCGCAGTGCACACGAGGGGGCTGGACTTCGCCTGTGATATCTACATCTGGGC GCCCTTGGCCGGGACTTGTGGGGTCCTTCTCCTGTCACTGGTTATCACCCTTTACTGCAACCACAGGAAC CGAAGACGTGTTTGCAAATGTCCCCGGCCTGTGGTCAAATCGGGAGACAAGCCCAGCCTTTCGGCGAGAT ACGTC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC206608 protein sequence
Red=Cloning site Green=Tags(s) MALPVTALLLPLALLLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFL LYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGCYFCSALSNSIMYFSHFVPVFLPAKPTTT PAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRN RRRVCKCPRPVVKSGDKPSLSARYV myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
![]() Sequencher program is needed, download here. |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_001768 |
ORF Size | 705 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers. |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_001768.2 |
RefSeq Size | 3035 bp |
RefSeq ORF | 708 bp |
Locus ID | 925 |
Cytogenetics | 2p11.2 |
Domains | ig, IGv, IG |
Protein Families | Adult stem cells, Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein, Transmembrane |
Protein Pathways | Antigen processing and presentation, Cell adhesion molecules (CAMs), Hematopoietic cell lineage, Primary immunodeficiency, T cell receptor signaling pathway |
MW | 25.7 kDa |
Gene Summary | The CD8 antigen is a cell surface glycoprotein found on most cytotoxic T lymphocytes that mediates efficient cell-cell interactions within the immune system. The CD8 antigen acts as a coreceptor with the T-cell receptor on the T lymphocyte to recognize antigens displayed by an antigen presenting cell in the context of class I MHC molecules. The coreceptor functions as either a homodimer composed of two alpha chains or as a heterodimer composed of one alpha and one beta chain. Both alpha and beta chains share significant homology to immunoglobulin variable light chains. This gene encodes the CD8 alpha chain. Multiple transcript variants encoding different isoforms have been found for this gene. The major protein isoforms of this gene differ by the presence or absence of a transmembrane domain and thus differ in being a membrane-anchored or secreted protein. [provided by RefSeq, May 2020] |
Citations (4)
The use of this cDNA Clones has been cited in the following citations: |
---|
Ano6 disruption impairs acinar cell regulatory volume decrease and protein secretion in murine submandibular salivary glands
,Munemasa, T;Gao, X;Melvin, JE;Mukaibo, T;,
J. Cell. Physiol. 2020
,PubMed ID 32329061
[CD8A]
|
Slc4a11 disruption causes duct cell loss and impairs NaCl reabsorption in female mouse submandibular glands
,Yang, NY;Mukaibo, T;Gao, X;Kurtz, I;Melvin, JE;,
Physiol Rep 2019
,PubMed ID 31833218
[CD8A]
|
Analysis of herpes simplex type 1 gB, gD, and gH/gL on production of infectious HIV-1: HSV-1 gD restricts HIV-1 by exclusion of HIV-1 Env from maturing viral particles
,Polpitiya Arachchige, S;Henke, W;Kalamvoki, M;Stephens, EB;,
Retrovirology 2019
,PubMed ID 30940160
[CD8A]
|
Gene-modified NK-92MI cells expressing a chimeric CD16-BB-ζ or CD64-BB-ζ receptor exhibit enhanced cancer-killing ability in combination with therapeutic antibody
,Chen, Y;You, F;Jiang, L;Li, J;Zhu, X;Bao, Y;Sun, X;Tang, X;Meng, H;An, G;Zhang, B;Yang, L;,
Oncotarget 2017
,PubMed ID 28415754
[CD8A]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
cDNA Clone Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
SC111602 | CD8A (untagged)-Human CD8a molecule (CD8A), transcript variant 1 |
USD 390.00 |
|
SC322577 | CD8A (untagged)-Human CD8a molecule (CD8A), transcript variant 1 |
USD 420.00 |
|
RG206608 | CD8A (GFP-tagged) - Human CD8a molecule (CD8A), transcript variant 1 |
USD 470.00 |
|
RC206608L1 | Lenti ORF clone of Human CD8a molecule (CD8A), transcript variant 1, Myc-DDK-tagged |
USD 640.00 |
|
RC206608L2 | Lenti ORF clone of Human CD8a molecule (CD8A), transcript variant 1, mGFP tagged |
USD 640.00 |
|
RC206608L3 | Lenti ORF clone of Human CD8a molecule (CD8A), transcript variant 1, Myc-DDK-tagged |
USD 640.00 |
|
RC206608L4 | Lenti ORF clone of Human CD8a molecule (CD8A), transcript variant 1, mGFP tagged |
USD 640.00 |
USD 350.00
USD 570.00
USD 379.00