NF2 (NM_000268) Human Tagged ORF Clone

CAT#: RC205883

Reviews ()
Write a review

NF2 (Myc-DDK-tagged)-Human neurofibromin 2 (merlin) (NF2), transcript variant 1



Reconstitution Protocol

USD 831.00

In Stock*

Size
    • 10 ug

Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol NF2
Synonyms ACN; BANF; merlin-1; SCH
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC205883 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCGGGGCCATCGCTTCCCGCATGAGCTTCAGCTCTCTCAAGAGGAAGCAACCCAAGACGTTCACCG
TGAGGATCGTCACCATGGACGCCGAGATGGAGTTCAATTGCGAGATGAAGTGGAAAGGGAAGGACCTCTT
TGATTTGGTGTGCCGGACTCTGGGGCTCCGAGAAACCTGGTTCTTTGGACTGCAGTACACAATCAAGGAC
ACAGTGGCCTGGCTCAAAATAGACAAGAAGGTACTGGATCATGATGTTTCAAAGGAAGAACCAGTCACCT
TTCACTTCTTGGCCAAATTTTATCCTGAGAATGCTGAAGAGGAGCTGGTTCAGGAGATCACACAACATTT
ATTCTTCTTACAGGTAAAGAAGCAGATTTTAGATGAAAAGATCTACTGCCCTCCTGAGGCTTCTGTGCTC
CTGGCTTCTTACGCCGTCCAGGCCAAGTATGGTGACTACGACCCCAGTGTTCACAAGCGGGGATTTTTGG
CCCAAGAGGAATTGCTTCCAAAAAGGGTAATAAATCTGTATCAGATGACTCCGGAAATGTGGGAGGAGAG
AATTACTGCTTGGTACGCAGAGCACCGAGGCCGAGCCAGGGATGAAGCTGAAATGGAATATCTGAAGATA
GCTCAGGACCTGGAGATGTACGGTGTGAACTACTTTGCAATCCGGAATAAAAAGGGCACAGAGCTGCTGC
TTGGAGTGGATGCCCTGGGGCTTCACATTTATGACCCTGAGAACAGACTGACCCCCAAGATCTCCTTCCC
GTGGAATGAAATCCGAAACATCTCGTACAGTGACAAGGAGTTTACTATTAAACCACTGGATAAGAAAATT
GATGTCTTCAAGTTTAACTCCTCAAAGCTTCGTGTTAATAAGCTGATTCTCCAGCTATGTATCGGGAACC
ATGATCTATTTATGAGGAGAAGGAAAGCCGATTCTTTGGAAGTTCAGCAGATGAAAGCCCAGGCCAGGGA
GGAGAAGGCTAGAAAGCAGATGGAGCGGCAGCGCCTCGCTCGAGAGAAGCAGATGAGGGAGGAGGCTGAA
CGCACGAGGGATGAGTTGGAGAGGAGGCTGCTGCAGATGAAAGAAGAAGCAACAATGGCCAACGAAGCAC
TGATGCGGTCTGAGGAGACAGCTGACCTGTTGGCTGAAAAGGCCCAGATCACCGAGGAGGAGGCAAAACT
TCTGGCCCAGAAGGCCGCAGAGGCTGAGCAGGAAATGCAGCGCATCAAGGCCACAGCGATTCGCACGGAG
GAGGAGAAGCGCCTGATGGAGCAGAAGGTGCTGGAAGCCGAGGTGCTGGCACTGAAGATGGCTGAGGAGT
CAGAGAGGAGGGCCAAAGAGGCAGATCAGCTGAAGCAGGACCTGCAGGAAGCACGCGAGGCGGAGCGAAG
AGCCAAGCAGAAGCTCCTGGAGATTGCCACCAAGCCCACGTACCCGCCCATGAACCCAATTCCAGCACCG
TTGCCTCCTGACATACCAAGCTTCAACCTCATTGGTGACAGCCTGTCTTTCGACTTCAAAGATACTGACA
TGAAGCGGCTTTCCATGGAGATAGAGAAAGAAAAAGTGGAATACATGGAAAAGAGCAAGCATCTGCAGGA
GCAGCTCAATGAACTCAAGACAGAAATCGAGGCCTTGAAACTGAAAGAGAGGGAGACAGCTCTGGATATT
CTGCACAATGAGAACTCCGACAGGGGTGGCAGCAGCAAGCACAATACCATTAAAAAGCTCACCTTGCAGA
GCGCCAAGTCCCGAGTGGCCTTCTTTGAAGAGCTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC205883 protein sequence
Red=Cloning site Green=Tags(s)

MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKD
TVAWLKIDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKIYCPPEASVL
LASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKI
AQDLEMYGVNYFAIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKI
DVFKFNSSKLRVNKLILQLCIGNHDLFMRRRKADSLEVQQMKAQAREEKARKQMERQRLAREKQMREEAE
RTRDELERRLLQMKEEATMANEALMRSEETADLLAEKAQITEEEAKLLAQKAAEAEQEMQRIKATAIRTE
EEKRLMEQKVLEAEVLALKMAEESERRAKEADQLKQDLQEAREAERRAKQKLLEIATKPTYPPMNPIPAP
LPPDIPSFNLIGDSLSFDFKDTDMKRLSMEIEKEKVEYMEKSKHLQEQLNELKTEIEALKLKERETALDI
LHNENSDRGGSSKHNTIKKLTLQSAKSRVAFFEEL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_000268
ORF Size 1785 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_000268.4
RefSeq Size 6046 bp
RefSeq ORF 1788 bp
Locus ID 4771
UniProt ID P35240
Cytogenetics 22q12.2
Domains B41, ERM
Protein Families Druggable Genome
MW 69.7 kDa
Gene Summary This gene encodes a protein that is similar to some members of the ERM (ezrin, radixin, moesin) family of proteins that are thought to link cytoskeletal components with proteins in the cell membrane. This gene product has been shown to interact with cell-surface proteins, proteins involved in cytoskeletal dynamics and proteins involved in regulating ion transport. This gene is expressed at high levels during embryonic development; in adults, significant expression is found in Schwann cells, meningeal cells, lens and nerve. Mutations in this gene are associated with neurofibromatosis type II which is characterized by nervous system and skin tumors and ocular abnormalities. Two predominant isoforms and a number of minor isoforms are produced by alternatively spliced transcripts. [provided by RefSeq, Jul 2008]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.